KEGG   Pelodictyon phaeoclathratiforme: Ppha_0776Help
Entry
Ppha_0776         CDS       T00731                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
pph00020  Citrate cycle (TCA cycle)
pph00640  Propanoate metabolism
pph00660  C5-Branched dibasic acid metabolism
pph00720  Carbon fixation pathways in prokaryotes
pph01100  Metabolic pathways
pph01110  Biosynthesis of secondary metabolites
pph01120  Microbial metabolism in diverse environments
pph01130  Biosynthesis of antibiotics
pph01200  Carbon metabolism
Module
pph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pph_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
pph_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ppha_0776
   00640 Propanoate metabolism
    Ppha_0776
   00660 C5-Branched dibasic acid metabolism
    Ppha_0776
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ppha_0776
Enzymes [BR:pph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ppha_0776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACF43068
UniProt: B4SEH6
Position
complement(809142..810320)
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQGKDILRKFGVAVPRGIVAYSPEEAKQAAEQLFDELGCPVVVIKAQIHAGGRGK
AGGVKLAKSPEESLDIAHQLIGMTLITHQTGPEGKEVRRVLVEEGMNIEKEFYVGITLDR
STSKNVLMVSTEGGMEIEKVAEETPERLLKIQIDPLFGMQGFQAREAAFFLGLKGEQFRN
AVNFITALYNAYISIDAALAEINPLVVTKEGKVLALDAKINFDDNALFRHKEFHELRDTN
EEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDMIQLAGGKPANFLDVGGSASPQ
TVEEGFKIILSDKNVKAILVNIFGGIVRCDRVAGGIIEAAKKIDLHLPVIVRLEGTNAPI
AQKMLDDSGLNLIAAKGLRDAAQKVQEALAAS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaatatcaaggcaaggatatcctgagaaaattcggggttgccgtgcca
agaggaattgtagcctattcacctgaagaagcaaaacaggcggctgagcagctttttgat
gagctcggttgtccggttgttgttataaaagcacagattcatgccggaggcagaggaaag
gctggtggagtaaaactcgccaaatcacctgaagagagccttgatattgcccaccaactg
attggcatgacgctcattacccatcaaaccggcccggaaggcaaagaggtcagaagagtt
cttgtcgaagagggtatgaatatcgaaaaggagttttatgtcggtattacccttgaccgc
tcaacctcgaagaatgttctgatggtttcgaccgaaggcggcatggaaattgagaaagtt
gctgaagagactccggaaaggctcctgaaaatccagattgaccctctctttggcatgcag
ggattccaggcacgcgaagccgccttctttctcgggctcaagggtgaacagttccgcaac
gccgtaaacttcatcactgcgctttacaacgcttatatctctattgacgccgcactggcc
gaaatcaatccgctggttgtcaccaaagagggaaaagtgcttgcactcgacgcaaaaatt
aactttgacgacaacgctcttttccgccacaaagagttccacgaactacgcgataccaac
gaagaggatccatttgaagtcgaagcctcaaaatccaatctcaactacgtccgccttgac
ggtaatgtcggttgcatggtcaacggcgcaggactggctatgggcaccatggacatgatc
cagcttgctggcgggaaaccggcgaatttccttgatgttggtggttcagcaagcccgcaa
actgttgaagagggattcaagatcattttgagtgacaaaaacgtcaaagcaatccttgtc
aatattttcggtggtattgttcgctgtgaccgcgtagcaggtggcattatcgaagccgca
aaaaaaatagacctgcacctgccagtcattgtccgccttgaaggaaccaatgcgccaata
gcacagaaaatgcttgatgattcaggcttgaaccttattgcggcaaaaggactccgtgat
gcggcccaaaaagtacaggaagcactggcagcctcctga

DBGET integrated database retrieval system