KEGG   Pelodictyon phaeoclathratiforme: Ppha_0780Help
Entry
Ppha_0780         CDS       T00731                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppha_0780 (gpmA)
   01230 Biosynthesis of amino acids
    Ppha_0780 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppha_0780 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Ppha_0780 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ppha_0780 (gpmA)
Enzymes [BR:pph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ppha_0780 (gpmA)
Exosome [BR:pph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ppha_0780 (gpmA)
  Exosomal proteins of melanoma cells
   Ppha_0780 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
813543..814292
Genome map
AA seq 249 aa AA seqDB search
MIKLVLLRHGESQWNRENRFTGWYDIDLTDQGREEAANAGKLLREGGFVFDVAYTSVLKR
AIRTLWSVLDAMDLMWIPVFKSWRLNERHYGALQGLNKSETSQKYGEEQVLVWRRSYDTP
PPALEKSDERYPGSEPRYADLAEEEIPLSECLKDTVDRFLPIWHETIAPEIRKGRKVIIA
AHGNSLRALVKYLDNISEEDIVGVNIPTGIPLVYELDDDLNALRSYYLGDQEALKKAVDA
VASQGKASQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactggtcttgttgcggcatggagaaagtcagtggaatcgggaaaatcgtttt
accgggtggtatgatattgacctgactgatcaggggagagaagaggctgcaaatgctggt
aaactccttcgggaggggggctttgtgtttgatgtagcctatacatcagtactgaaacgt
gctatccggactctttggagtgtgctggatgcaatggatctgatgtggattcctgttttc
aagagctggaggctgaacgagcgccattatggtgcgctgcaggggcttaataaatcggaa
acgtcgcagaaatatggcgaggaacaggttcttgtttggcggagaagttacgataccccg
cctcctgcgctggagaagagtgatgagcgctaccctggatccgaacctcgctacgccgat
ctggctgaagaggagattcctttgagtgaatgtctcaaagatacggtggatcgctttttg
ccgatatggcatgaaacgatagccccagaaatccgcaaaggccgcaaggtgattattgca
gctcatggtaactcattgcgtgccctggtcaaatatcttgacaatatttccgaggaagat
attgttggtgtaaatattcccaccggaattccgttagtctatgaacttgatgatgatctt
aacgcattgagaagttattatctcggcgatcaggaagccttgaaaaaggcggttgatgct
gtggccagccaggggaaagcaagccaatag

DBGET integrated database retrieval system