KEGG   Pelodictyon phaeoclathratiforme: Ppha_0780Help
Entry
Ppha_0780         CDS       T00731                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:pph01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pph01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pph00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:pph00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pph00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
813543..814292
Genome map
AA seq 249 aa AA seqDB search
MIKLVLLRHGESQWNRENRFTGWYDIDLTDQGREEAANAGKLLREGGFVFDVAYTSVLKR
AIRTLWSVLDAMDLMWIPVFKSWRLNERHYGALQGLNKSETSQKYGEEQVLVWRRSYDTP
PPALEKSDERYPGSEPRYADLAEEEIPLSECLKDTVDRFLPIWHETIAPEIRKGRKVIIA
AHGNSLRALVKYLDNISEEDIVGVNIPTGIPLVYELDDDLNALRSYYLGDQEALKKAVDA
VASQGKASQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactggtcttgttgcggcatggagaaagtcagtggaatcgggaaaatcgtttt
accgggtggtatgatattgacctgactgatcaggggagagaagaggctgcaaatgctggt
aaactccttcgggaggggggctttgtgtttgatgtagcctatacatcagtactgaaacgt
gctatccggactctttggagtgtgctggatgcaatggatctgatgtggattcctgttttc
aagagctggaggctgaacgagcgccattatggtgcgctgcaggggcttaataaatcggaa
acgtcgcagaaatatggcgaggaacaggttcttgtttggcggagaagttacgataccccg
cctcctgcgctggagaagagtgatgagcgctaccctggatccgaacctcgctacgccgat
ctggctgaagaggagattcctttgagtgaatgtctcaaagatacggtggatcgctttttg
ccgatatggcatgaaacgatagccccagaaatccgcaaaggccgcaaggtgattattgca
gctcatggtaactcattgcgtgccctggtcaaatatcttgacaatatttccgaggaagat
attgttggtgtaaatattcccaccggaattccgttagtctatgaacttgatgatgatctt
aacgcattgagaagttattatctcggcgatcaggaagccttgaaaaaggcggttgatgct
gtggccagccaggggaaagcaagccaatag

DBGET integrated database retrieval system