KEGG   Pelodictyon phaeoclathratiforme: Ppha_0840Help
Entry
Ppha_0840         CDS       T00731                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ppha_0840
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ppha_0840
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ppha_0840
Enzymes [BR:pph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ppha_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
876222..877025
Genome map
AA seq 267 aa AA seqDB search
MSENRITQLVKQDKKFLIAYYMPEFPVTGSTLPVLEALEESGVDIIELGMPYSDPIGDGP
VIQDAAHTAIRNGVTIKYLLELVRRARQGEGCKKITAPILLMGYCNPLIAYGGDCFLHDA
LEAGVDGLLIPDLPPEEAADFLEKAKGFGLTVVFLVSPVTPPERIELIDSLSTDFSYCLA
VNGTTGTAKLSDTATESAVDDYLKRVRQHARKKFVVGFGIKDKAQVEHMWNFADGAVVGS
ALLQYIAASATPEETARLAAEFWKTLR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaatcgaattacccagttggtgaagcaggataaaaaattcctgattgcctat
tatatgccggaatttccggtaactggctcgacgctccccgtgcttgaggcgcttgaggag
agcggggttgatatcattgagcttggtatgccctattctgacccgataggcgatgggcca
gtgattcaggatgcagcccataccgctatccgtaacggtgtgaccatcaaatatcttctt
gaactggtacgcagagcccggcagggcgaagggtgcaaaaaaattacagcccccatcctt
ctgatgggctactgcaaccccctgattgcttacggtggtgattgttttctgcatgatgcc
cttgaggcgggagttgacggattgcttattcccgatcttcctcccgaggaggcggcagat
tttctcgaaaaagcaaaggggtttggccttaccgttgtctttcttgtttcaccggttact
ccacccgaaaggatagagctgatcgacagcctctcgaccgatttttcctactgtcttgcg
gtcaatggtacaacagggacagcgaagctttccgatacggcgacagagtcagcggttgat
gactatctgaaaagggtacgccaacatgcccggaaaaaatttgttgtcggttttggcatc
aaggataaggcgcaggtagagcatatgtggaactttgcagacggagccgtcgtgggaagt
gcccttttgcagtacatcgcagcttctgcaactcctgaagagacagcccgcctggccgcg
gagttctggaaaacgttgcgctga

DBGET integrated database retrieval system