KEGG   Pelodictyon phaeoclathratiforme: Ppha_0875Help
Entry
Ppha_0875         CDS       T00731                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pph  Pelodictyon phaeoclathratiforme
Brite
Enzymes [BR:pph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Ppha_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
913198..913629
Genome map
AA seq 143 aa AA seqDB search
MMQTSENGFALIRKYEGLRLATYVCPGGKLTIGYGHTGPDVTTGKKIDEEEANALLVKDV
QRFERAVNGLVTAPMTQGMFDALISFSFNLGVGSLKSSTLLKKLNAGNLTGAADEFLKWN
KAGGKVLAGLSARRESERERFLV
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagacaagtgaaaacgggtttgctcttattcgaaagtatgagggtttgcgtctt
gcgacgtatgtctgtccggggggaaagctgacgatcgggtatggccatacgggcccggat
gttacaacggggaaaaaaattgatgaagaggaggcaaatgcacttctggtcaaggatgtt
cagcgttttgagcgtgcagttaacgggctggtgacggcgccgatgacgcaggggatgttc
gatgcgctgatcagtttttcctttaatcttggcgtcggctcattgaaaagttcgaccttg
ctgaaaaaactgaatgccggtaatctgactggtgcggcggatgagtttttgaagtggaac
aaggcgggtgggaaggtgctggcgggcctctctgcgcggcgcgagagtgagcgggagcgc
tttttggtttga

DBGET integrated database retrieval system