KEGG   Pelodictyon phaeoclathratiforme: Ppha_0949Help
Entry
Ppha_0949         CDS       T00731                                 

Definition
(RefSeq) uroporphyrinogen-III synthase (EC:4.2.1.75)
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ppha_0949
Enzymes [BR:pph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ppha_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(987977..988720)
Genome map
AA seq 247 aa AA seqDB search
MKTVLVTRPKDQAASFVKKLEEYGLNSIVFPTIEIRPVSGWKVPDLALFDGVFFTSPNSV
GLFMDRLLKESPDELKNLQKLKVWAVGKTTSSDLAAHGVTTEPIPKIADAVTLMEEIGSE
AIAGHTFLFLRGTLSLGVIPEVIEKRGGHCVELTVYANLTPSLEESAKIKSLLEQGELSC
LSFTSPSTAINFFEAMGTTALPSGVQIAAIGTTTANALKKLGVHVDIIPESFDAPSFAKA
IAEKLTD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgttcttgttacccgtccaaaagatcaggctgcatcatttgtaaagaaactg
gaagagtacggtctgaactcgattgtttttccgacaatcgagatcaggccggtctccggc
tggaaggttcctgaccttgccctgtttgacggagttttttttaccagccccaacagtgtc
ggcttatttatggatcggctgctcaaagagagccctgatgagctgaaaaacctccagaag
ctcaaggtttgggctgtcggaaaaacaacctcctccgaccttgcggcacacggtgtaaca
accgaaccaataccgaaaattgccgatgccgtcacgctcatggaagagatcggaagtgag
gcaatagcaggccacacctttctttttctaagaggaactctctctcttggtgttattccc
gaagtgattgaaaaacggggagggcattgcgttgagttgaccgtttatgccaacctgaca
ccttcacttgaagagagcgcaaaaataaaatcgctgcttgagcagggcgaactctcctgc
ctctcctttaccagcccctcaaccgccatcaatttttttgaggctatggggacaaccgca
cttccctccggagtgcagattgccgccataggaaccacaaccgccaatgcgctcaaaaaa
cttggcgttcatgtcgacattatccccgaatcattcgacgcgccaagctttgcaaaagca
atagcggaaaagctgactgattga

DBGET integrated database retrieval system