KEGG   Pelodictyon phaeoclathratiforme: Ppha_1101Help
Entry
Ppha_1101         CDS       T00731                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pph01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pph00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1131468..1132556)
Genome map
AA seq 362 aa AA seqDB search
MKQLINPLYKKIVVKVGTNVITTKKGELDLEILQQLTTQIAELQKQGIQIILVSSGAVGA
GRSVVKLSGTIAPVAARQVLSSTGQIKLISSYNELFAKHGLITAQILVTKSDFSDRLHYL
NMQTCFSSLLQQNIIPVVNENDAVSVTELMFTDNDELSGLIASMMDVEGYIILSHVDGLF
DMKSGNGTIIPIIDPSTKHFHQYINPGKSEFGRGGMLTKCHIAQKLSRLGITVHIANGRT
PGILLSLLEGEQTGTKFLPQKATHGPKRWIANSEGMEKGAVTVNMGAEMALVAGDRANSL
LPVGIESVEGRFLKGDIIKVCATDGTIIGYGMAQYSSEKTVAIMGLQDQKPLIHYDYLYI
TT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagttgatcaatcctctctataaaaaaatagtcgtcaaagtcggcaccaacgtc
attaccacaaaaaaaggcgaacttgaccttgaaattctccagcagcttaccacccagatt
gcggaactgcaaaaacagggaattcagatcattctcgtctcgtcgggagctgtcggcgcc
ggacgctcggtggtcaaactctccggaaccatcgcgccggttgcggcccgccaggtactt
tcctctacaggccagatcaaactgatcagcagctacaacgagctctttgcaaagcacggg
ctgatcaccgcccagattctggtcaccaagagcgatttcagcgaccgcctgcactatctc
aacatgcagacctgcttcagctcccttctgcagcaaaacataatccccgttgtcaatgag
aacgatgccgtgtcagtgaccgaattgatgtttaccgacaatgatgagctctccggcctc
attgcatccatgatggatgttgagggctacatcattctctcgcatgttgatggccttttt
gacatgaaatcaggcaatggcaccatcatccccatcattgatccctcgaccaaacatttc
caccagtatatcaatccgggaaaatcagaattcggcagaggagggatgttgaccaagtgc
catatcgcgcagaaactctcccgtctcggcatcaccgtccatattgccaacggacgcact
cccggtattctcctctcgcttcttgagggagaacagaccggcacaaaatttctgccgcaa
aaggcaacccacggcccgaaacggtggattgcaaacagcgaagggatggaaaagggagcg
gtcaccgtcaacatgggcgctgaaatggccctggtggccggagatcgagccaacagcctg
ctgccggtcggtattgaatcggttgaagggcgtttcctgaaaggcgacatcatcaaggtc
tgtgcgacggacggaaccatcatcggctacggtatggcgcaatacagctcggaaaaaaca
gttgcaatcatgggtctgcaggatcagaaacccctgattcattacgattacctctatatc
accacctga

DBGET integrated database retrieval system