KEGG   Pelodictyon phaeoclathratiforme: Ppha_1130Help
Entry
Ppha_1130         CDS       T00731                                 

Definition
type III restriction system endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
pph  Pelodictyon phaeoclathratiforme
Brite
Enzymes [BR:pph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Ppha_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1171304..1174279
Genome map
AA seq 991 aa AA seqDB search
MKLHFEPNLDYQLQAVEAVCDLFRGQEICRTEFTVTMPTTKDMQFPGMESDLGIGNRLTL
LDDDLLKSLHDIQLRNGLPPSGTLASGDFTVEMETGTGKTYVYLRTIFELNKRYGFTKFV
IVVPSVAIKEGVYKTLQITEDHFKGLYAGVPFEYFLYDSSKLGQVRNFATSSQIQIMVMT
VGAINKKDVNNIYGKGANESTGGEKPIDLVKAVRPILIIDEPQSVDGGLSGAGKTALDAM
SPLCTLRYSATHVDKHQMVYRLDAVDAHDKGLVKQIEIAAATVEDAFNKPYVRLLKVENK
RGRISALVELDKMTASGVRRKESVVVDGDNLEMVTGRAIYADCSIGEIRVEKGKEFMELR
FPGGEQFLKPGEAYGDVDALAVQRQMIRRTIKEHLDKELRLRPQGIKVLSLFFIDEVAKY
RSYDSDGNSVKGDYARIFEEEYRRAAKLPDYFTLFSEVDLTHAPEEVHNGYFSIDKKGGW
TNTEENNQGNRESAERAYNLIMKEKEKLLSLETPLKFIFSHSALKEGWDNPNVFQICALR
EMGSERERRQTIGRGLRLCVNQHGLRLRGFEVNTLTVIATESYEQFAENLQREIEAETGI
RFGIVEEHQFAAISVTTDEGVSVPLGFEQSKLLWEHLKEQNYIDSKGKVQDSLKSALKEG
TLLVPEQFRPQLDQITAVLKKLAGRLEIKNANERRQVHTRQAVLHSPEFKELWERIKHKT
TYRVEFDNEKLVESCIKALQNAPAILKTRMQWHKAEIVIGKSGVEATERSGAATVVLDEN
DIELPDLLTDLQDRTRLTRRTIHRILIGSERLDDFKRNPQQFIELAAEAIKRCKQLAVVD
GIKYHRLGDEHFYAQELFEQQELTGYLKNLIPVQKSVYEQVVYDSDPEATFADQLEKNLA
IKVYAKLPGWFRIPTPLDTYNPDWAVLVEKDGEERIYFVVETKSSLFTDDLRDKESAKIE
CGKAHFKALSICETPARYVVARSLDDVLNRV
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactgcactttgaaccgaaccttgactatcaactacaggcggttgaagcggtctgc
gacctctttcgcgggcaggagatctgccgcacggagtttaccgttaccatgccgaccacg
aaagacatgcagtttcctggcatggagagtgatcttggcattggcaaccggcttacgttg
cttgatgatgacctgctcaaaagcctgcatgatattcagctccgcaacggcctgccgcct
tccggaacccttgcttccggcgacttcacggtagagatggagaccggaacgggcaaaacc
tacgtctatctgcgtaccatctttgaactcaacaagcggtacggctttaccaagtttgtg
attgtcgtcccgtcagtggctatcaaggagggggtttacaaaacccttcagattaccgaa
gatcacttcaaggggctctatgccggagtaccttttgaatatttcctctatgactcctca
aaactggggcaggtgcgtaattttgccaccagctcgcaaatccagattatggtgatgacg
gttggcgccatcaacaaaaaggatgtcaataatatttacggtaagggtgccaatgagtct
actggcggggaaaagccgattgatcttgtcaaggcggtgcggcccatcctgattattgat
gaaccgcaaagtgtggatggtggtctttccggtgctggcaaaaccgcgctcgatgccatg
agcccgctttgtaccttgcgttattccgctacgcatgtggacaagcaccagatggtttat
cgtcttgatgcggttgatgcgcacgataaggggctggtgaagcagattgagattgctgcc
gctacggtggaagatgccttcaacaagccttatgttcgtctcttgaaggttgagaacaag
cggggcaggatttccgcactcgttgaactcgacaagatgacggccagcggtgtcaggcga
aaagagagtgttgtggttgatggtgataatcttgaaatggttaccggacgggcgatctat
gctgattgctctatcggtgaaattcgtgttgaaaagggcaaggagtttatggagttgcgc
ttccccggtggtgagcagttcctgaaacctggcgaggcgtatggagatgtggatgctctt
gccgttcagcgccagatgattcgccgtaccatcaaggagcacctcgacaaggagctgcgt
ctgcgcccgcagggtatcaaagtgctttcgctcttctttattgatgaggttgccaaatac
cgctcttacgacagtgacggtaactcagtgaagggcgattatgcccgcattttcgaggag
gagtaccgccgggcggcaaagctgcctgattattttacactgttcagtgaggttgacctg
acgcatgcccccgaagaggtgcataacggctatttctcgatcgacaaaaaaggtggctgg
accaataccgaggagaacaatcagggcaatcgtgaaagtgctgaacgggcctacaacctg
atcatgaaggagaaagagaagctgctctcactggagacaccactgaaattcatcttttct
cactctgcactcaaggaggggtgggacaaccccaatgtcttccagatttgtgcactgcgt
gaaatgggctcagagcgtgaacgccgccagacgatagggcgtggtctgcggttatgcgtc
aatcagcacggtctgcgactgcgtggatttgaagtcaatacgctgacggttattgcaacg
gagagttatgagcagtttgccgaaaatcttcagagagagattgaggctgaaaccggtatt
cgattcgggattgtcgaagaacaccagtttgcggcgatttccgttactactgacgaagga
gtctcagttcctcttggattcgagcagtcgaagctcttgtgggagcatctgaaagagcag
aactatatcgacagtaagggcaaggtgcaggattcgctgaaaagtgcgctcaaggagggg
actcttcttgtgccggagcaattcaggccacagcttgatcagattaccgctgtactgaaa
aagcttgcaggacgtctggaaatcaagaatgcgaatgagcggagacaggtacacacccgg
caggcagtgctgcacagtccggaattcaaagagctttgggagcgtatcaagcataaaacg
acctatcgggtggagttcgacaatgaaaagctggtggagagctgcatcaaggcattacag
aatgctcccgccattttgaagacacgcatgcagtggcacaaggctgaaatcgttattggt
aaatcgggcgttgaagctactgaacggagtggtgccgcaacggttgtgcttgatgaaaac
gatattgagttgcctgaccttcttacggatctgcaggatcgtacccggctgacccgccgc
acgattcatcgtattttgatcggaagtgagcgactcgacgattttaagcgtaacccgcaa
cagttcattgagctggcagccgaagccatcaagcggtgcaagcaactcgctgttgtggat
ggcatcaagtatcaccgccttggtgacgaacatttttacgcccaggagctttttgagcaa
caggaacttactggttacctcaagaaccttatcccggttcagaaatcagtctatgagcag
gtggtctatgactccgatcccgaagcaacttttgctgatcagttggagaagaatctggcc
atcaaggtctatgcaaagcttccgggatggttcaggattccaacaccactcgatacctac
aatcccgactgggcggtactcgtcgaaaaggatggcgaagagcgaatctactttgttgtc
gagaccaagagcagcctgtttaccgatgacctgcgtgacaaggagagtgcaaagattgag
tgcggcaaagctcacttcaaggcgctcagtatttgcgaaacccccgcaaggtatgttgtg
gcccgctctttggatgacgtgctgaacagggtttaa

DBGET integrated database retrieval system