KEGG   Pelodictyon phaeoclathratiforme: Ppha_1156Help
Entry
Ppha_1156         CDS       T00731                                 

Definition
histidinol-phosphate aminotransferase
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pph01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pph00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pph00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:pph00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pph00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:pph00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1206717..1207784
Genome map
AA seq 355 aa AA seqDB search
MKRDIQYLLNPALQNIATYRVEGGQQAEIKLNQNESPFDVPMWLKEEITGEFIKEPWNRY
PDILPYRGMQVYADFLGISPDSVMMSNGSNEMLYTIFLACLGPGRKVLIPDPSFSLYEKI
ALLLQSQIVTVPMLPDLDFDLEAILRTAHDEAVDFIVISTPNNPTGKSLTFEEVRLIAQS
SDAIVLVDEAYIEFSRQRSVLELIDELPNLVVLRTMSKAIALAGIRIGFALANPLLMAEI
AKPKIPFASSRLAEITLSMVLANYSLVTDAVSYILHEREKLYTAMLTIDGVEPFVSDTNF
LIIRVSDAGSVFQNLQSQGILVRNVSGYRLMENCLRFNVGLVDENQQLIAKLRQF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagatatacagtaccttcttaatccggcattacagaatattgcgacctatcgg
gttgaggggggacagcaggctgagataaagctgaaccagaacgaaagtccttttgatgtg
ccgatgtggctcaaggaggagattacaggagagtttatcaaggaaccctggaatcggtat
ccggatattcttccctacaggggaatgcaggtttatgcggattttcttggcatttcgcct
gattccgtaatgatgagcaacggatcgaacgaaatgctctacaccatatttcttgcctgt
cttggacctggcaggaaggtgctgattcctgacccttcattttcgctgtacgaaaaaatt
gcgctacttcttcagtcgcagattgtcacggttcccatgcttcctgatcttgattttgat
ctggaggcaattctgcgtactgcacatgatgaagctgttgattttattgtcatctccaca
ccgaacaatcctacaggaaaatcactcacgtttgaagaggttcgtcttattgcacaatct
tctgatgccatcgttctggttgatgaggcctatattgagttctcacggcaacgctctgtt
cttgaactgatagacgaactgccgaatcttgttgtgcttcggactatgtccaaagcaatc
gctctggcaggaattcgtattggttttgcgcttgccaatcctcttctgatggctgaaatc
gccaaaccgaaaattccttttgcatcaagcagacttgccgagataacactttcaatggtg
ctggcaaattactctcttgttactgacgctgtatcctatattctacatgaacgggaaaag
ctctataccgcaatgcttaccattgatggtgttgagccttttgtgagtgatactaatttt
ttgattatcagagtctccgatgcgggttccgtgtttcaaaaccttcagagccagggtatt
ttggtgagaaatgtttccggttaccggctcatggaaaactgcctgagatttaatgttggt
ctcgttgatgaaaatcagcagctcattgcaaaactgaggcagttttag

DBGET integrated database retrieval system