KEGG   Pelodictyon phaeoclathratiforme: Ppha_1156Help
Entry
Ppha_1156         CDS       T00731                                 

Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
pph00340  Histidine metabolism
pph00350  Tyrosine metabolism
pph00360  Phenylalanine metabolism
pph00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pph00401  Novobiocin biosynthesis
pph01100  Metabolic pathways
pph01110  Biosynthesis of secondary metabolites
pph01130  Biosynthesis of antibiotics
pph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Ppha_1156
   00350 Tyrosine metabolism
    Ppha_1156
   00360 Phenylalanine metabolism
    Ppha_1156
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ppha_1156
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Ppha_1156
Enzymes [BR:pph01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Ppha_1156
Amino acid related enzymes [BR:pph01007]
 Aminotransferase (transaminase)
  Class II
   Ppha_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACF43431
UniProt: B4SGL8
Position
1206717..1207784
Genome map
AA seq 355 aa AA seqDB search
MKRDIQYLLNPALQNIATYRVEGGQQAEIKLNQNESPFDVPMWLKEEITGEFIKEPWNRY
PDILPYRGMQVYADFLGISPDSVMMSNGSNEMLYTIFLACLGPGRKVLIPDPSFSLYEKI
ALLLQSQIVTVPMLPDLDFDLEAILRTAHDEAVDFIVISTPNNPTGKSLTFEEVRLIAQS
SDAIVLVDEAYIEFSRQRSVLELIDELPNLVVLRTMSKAIALAGIRIGFALANPLLMAEI
AKPKIPFASSRLAEITLSMVLANYSLVTDAVSYILHEREKLYTAMLTIDGVEPFVSDTNF
LIIRVSDAGSVFQNLQSQGILVRNVSGYRLMENCLRFNVGLVDENQQLIAKLRQF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagatatacagtaccttcttaatccggcattacagaatattgcgacctatcgg
gttgaggggggacagcaggctgagataaagctgaaccagaacgaaagtccttttgatgtg
ccgatgtggctcaaggaggagattacaggagagtttatcaaggaaccctggaatcggtat
ccggatattcttccctacaggggaatgcaggtttatgcggattttcttggcatttcgcct
gattccgtaatgatgagcaacggatcgaacgaaatgctctacaccatatttcttgcctgt
cttggacctggcaggaaggtgctgattcctgacccttcattttcgctgtacgaaaaaatt
gcgctacttcttcagtcgcagattgtcacggttcccatgcttcctgatcttgattttgat
ctggaggcaattctgcgtactgcacatgatgaagctgttgattttattgtcatctccaca
ccgaacaatcctacaggaaaatcactcacgtttgaagaggttcgtcttattgcacaatct
tctgatgccatcgttctggttgatgaggcctatattgagttctcacggcaacgctctgtt
cttgaactgatagacgaactgccgaatcttgttgtgcttcggactatgtccaaagcaatc
gctctggcaggaattcgtattggttttgcgcttgccaatcctcttctgatggctgaaatc
gccaaaccgaaaattccttttgcatcaagcagacttgccgagataacactttcaatggtg
ctggcaaattactctcttgttactgacgctgtatcctatattctacatgaacgggaaaag
ctctataccgcaatgcttaccattgatggtgttgagccttttgtgagtgatactaatttt
ttgattatcagagtctccgatgcgggttccgtgtttcaaaaccttcagagccagggtatt
ttggtgagaaatgtttccggttaccggctcatggaaaactgcctgagatttaatgttggt
ctcgttgatgaaaatcagcagctcattgcaaaactgaggcagttttag

DBGET integrated database retrieval system