KEGG   Pelodictyon phaeoclathratiforme: Ppha_1175Help
Entry
Ppha_1175         CDS       T00731                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ppha_1175 (recR)
DNA repair and recombination proteins [BR:pph03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ppha_1175 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1229003..1229617
Genome map
AA seq 204 aa AA seqDB search
MRYTSAALESLIDEFAKLPGVGRKTAQRLAMYILREPRAEAERLAEALLEAKDNVIRCSV
CQNITDVGVDPCALCTSKARDRSVICVVESPVDMLAFEKTGHYKGLYHVLHGVISPLDGI
GPDDIKVRELLLRFTMPQSPAVREVVLALNPTIEGETTALYLSKLLKPLGIHVTKIARGI
PVGAELEFIDEATLSRAMEGRTVV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatacttcggctgccctggaatctcttattgatgaatttgcaaaactccctggt
gtcggacgcaaaactgcccagcgtcttgccatgtatattttgcgtgagccaagagctgag
gcagaaaggctggccgaagccctgcttgaagccaaagataacgttattcgttgttctgtt
tgccagaacatcactgatgtcggcgtcgatccttgtgcactctgtaccagcaaggcacgt
gaccgttcagtgatctgcgttgtcgaatctcccgttgatatgctcgcttttgaaaaaacc
ggccattacaaggggctctaccatgttttgcatggagttatctcaccccttgatggtatt
ggtcctgacgacatcaaggtgcgggaactgttgttgcggttcacaatgccgcagagtcca
gcagtcagggaggttgttcttgccctgaatccgaccattgaaggagaaacaacagcgctc
tatctcagcaagcttctcaagccacttggcatccatgttacaaaaatagctcgcgggatt
ccagttggagcggagcttgaatttatcgatgaagcaaccctttcacgggcaatggaagga
cgcacggttgtatag

  All links  
No link information was found.   
DBGET integrated database retrieval system