KEGG   Pelodictyon phaeoclathratiforme: Ppha_1353Help
Entry
Ppha_1353         CDS       T00731                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
pph  Pelodictyon phaeoclathratiforme
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1417259..1418254
Genome map
AA seq 331 aa AA seqDB search
MNKKILVTGATGFIGSCLVKKLALTDDEVSILVRKNSDLTSLSDVLHKVKLVYGDITNRS
SLDAAMKGIDLVYHSAGLTYMGDKKNALLYKINVEGTRNMLQASAAAKVTRFVHVSSITA
VGIAFDKKPVDESVIWNFHQIGLEYARTKHLSEVEVAQAVKNGLDCVIVNPAFVFGAGDI
NFNAGRIIKDIYNKKLPFYPLGGICVVDVEIVSDAIISAMQKGKTGERYILGGENVSYKQ
LADTISKITGAPRVNFPLPFWMAKILKQALDLYKNKNRISKLFNMSMFGVASHFLYFDSA
KAMRELNMRYEPHEHSIRNAYEWYRDRNMLG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaaaaaatccttgtaaccggagcaactggttttattggttcgtgtcttgttaaa
aagctggctttaactgatgatgaagtttcaattcttgtccgaaaaaattcggatttaacc
tctctctccgatgtcctgcacaaggtcaagctggtttatggtgatattaccaacaggagc
tcacttgatgctgcaatgaaaggcattgatcttgtctatcactctgcgggtcttacctat
atgggggataaaaaaaatgccctgctttataaaatcaatgttgaaggtacccgcaatatg
ctgcaggcatcagccgcagccaaagtgacaagatttgttcatgtcagttctatcacagcg
gttggaattgctttcgacaaaaaacctgtcgatgaatccgtcatatggaatttccaccag
atcggtctggaatatgcaaggacgaaacatctttcagaagtcgaggtggctcaagcggtg
aaaaatgggcttgactgtgtcattgtcaatccggcatttgtgtttggagcaggcgatatt
aattttaatgcaggacggatcatcaaagatatttacaataagaaactgccgttttatccc
ttgggcggaatctgtgtagtcgatgttgagattgtttcagatgcgattatatccgccatg
caaaaaggaaaaacgggtgaacggtatatccttggtggtgaaaatgtctcttacaagcag
cttgcagataccatttcaaaaattaccggagctccgagagtcaattttcctctccctttc
tggatggcaaaaatactgaaacaggcgctggacctctataaaaacaagaatcggatatcc
aagctcttcaacatgtccatgttcggggtagcatctcatttcctctatttcgattcagca
aaggctatgcgtgagctgaatatgcggtacgaaccccatgaacacagcattagaaatgcc
tacgaatggtatcgtgatcgtaatatgcttggttga

DBGET integrated database retrieval system