KEGG   Pelodictyon phaeoclathratiforme: Ppha_1392Help
Entry
Ppha_1392         CDS       T00731                                 

Definition
ATP-grasp domain-containing protein
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppha_1392
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ppha_1392
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ppha_1392
Enzymes [BR:pph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Ppha_1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1455572..1456768
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPDRLAQLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKLGLNLDEAYAAAKEMIGRQIGTSVVRQVIVAEMLDHDEEYYLSIAGNRDGSELLL
SNKGGVDIEDNWDTVKRLVISLDETPTIEHITEAALEAGFTGEVAERVAKIASRLILCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNVDWDARFRHADWDFKPVSEIGRSYTEAEQQI
MDIDARIKGSVKLVEVPGGNIALLTAGGGASVFYSDAVVARGGSIANYAEYSGDPPDWAV
EALTETICRLPNIKHIIVGGAIANFTDVKATFNGIINGFRESKSKGYLENVQIWVRRGGP
NENQGLAAMKKLQEEGFDIHVYDRSMPMTDIVDLALNS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggccagccatgaaactattcaacaaatggggcattcctgtg
ccaaattatgttgtgatcatggatcccgaccgccttgcccaacttggggaagctaataaa
tggttgagagaatcaaaactcgttgttaaagctcacgaagctatcggcgggcggtttaag
ctcgggctggtcaagcttggactgaatcttgacgaggcttatgctgcagcaaaagagatg
attggacgtcagataggcacatcagtcgttcgtcaggttattgttgcagagatgcttgat
cacgatgaggagtattatttatctattgccggtaaccgcgacgggagtgaacttcttctt
tccaacaagggtggagttgatatcgaagacaactgggatacggtaaagaggcttgtcatt
tctcttgatgaaaccccgacgattgaacacattaccgaagcagctcttgaagctggcttc
accggtgaagtcgccgaacgtgttgctaaaattgcatcacgccttattctctgtttcgac
aatgaagatgctcaatcaattgagatcaatccacttgtcatacgcaagagcgacatgcga
tttgcagctcttgatgccgttatgaatgttgattgggatgcacgtttccgtcatgctgac
tgggatttcaaaccagtttccgaaatcggaagatcctatacagaggccgaacagcagatc
atggatatcgatgcccgcattaagggatcagtcaagttggttgaagtaccgggtggaaac
attgctctccttacagcaggcggcggcgcttcggttttttattccgatgccgtggtagca
agaggcggctcaattgccaattatgcagagtattccggtgatcctccggattgggcagta
gaggctttgacagaaacgatctgcaggcttcctaatatcaagcatatcatcgtcggtggt
gcaatagccaacttcacggatgtcaaggcaacgttcaacgggattatcaatggattccgt
gagagcaaatcaaaaggataccttgaaaacgtgcagatttgggtaagacgcggtggaccg
aatgagaatcagggacttgccgcaatgaaaaagctgcaggaagagggatttgacattcac
gtttatgatcgcagcatgcctatgaccgatattgtcgatcttgcccttaactcataa

DBGET integrated database retrieval system