KEGG   Pelodictyon phaeoclathratiforme: Ppha_1432Help
Entry
Ppha_1432         CDS       T00731                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
pph03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ppha_1432
Enzymes [BR:pph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Ppha_1432
DNA repair and recombination proteins [BR:pph03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Ppha_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 AAA_11 UvrD_C_2 Viral_helicase1 Helicase_RecD UvrD-helicase AAA_16 PhoH AAA_22 AAA DUF2075 UvrD_C AAA_5 TrwB_AAD_bind AAA_28 ResIII
Motif
Other DBs
NCBI-ProteinID: ACF43689
UniProt: B4S9Z3
Position
complement(1502841..1504571)
Genome map
AA seq 576 aa AA seqDB search
MSRVYQERAIDRHFAAFICHQATGRVSELFRLVVSLASSAVGQGSSCLNLQDIAEESIVI
ENKEFRLPRLDALMELLKSATVVSFPGGHFRPLVLDATGRLYLYRYWHYEQELQRTILRK
AGAAFDNIDETILLDALERLFPSSGRRESDRQKDATVFALRRQFCVLSGAPGTGKTSTVV
RILALLREQKWGMKQRIAMAAPTGKAAARLKTSISDIKRTLDCSDEVKSAIPDDVVTIHR
LLGTISGSSRFRHSASNPLPFDTVIIDEASMVALPLMSLLVTALKADARLILLGDHNQLA
SVEAGSVFGDICSAGSDNNASPLSNSMVLLEKNYRFHPGSGIAEISRAVNEGLEREAVSL
LKRSRSSGVTWQELPAPEELQHALANKAVEGFHSYLDAASPAEALERFDRFRILCALRDG
PYGVSGLNRTVENILARKALISPASTFYRGRPLMITVNNYAMRLFNGDTGILFPDPENGG
SLRAFFFAPDGEIRSIAPERLPQHETAFAITIHKSQGSEFDRLLMLLPPIDSEILTRELI
YTGITRAKESVEIWANEEVFCAAVKKQTKRSSGLHF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagtgtatcaggaacgggctatcgatcgccattttgcagcatttatctgccac
caggcgactggcagggtaagtgagctgttccgtcttgttgtatcccttgccagtagcgct
gtcgggcaggggagcagttgcctgaaccttcaggatattgcggaagagagcattgtaatt
gagaacaaggagtttcgtcttccccgacttgatgctctgatggagcttttgaagagcgct
actgtcgtcagttttcccggcggccactttcgtcctttggtgcttgatgctaccggtcgc
ctctatctctaccgttactggcattatgaacaggagctccaaagaacgattcttcgaaaa
gcaggagccgcttttgacaatattgatgaaaccatactgcttgacgctcttgaacgactt
tttccgtcaagtggcaggcgggaaagtgaccgtcagaaggatgcgactgtttttgccctg
cgcaggcagttctgtgttctttccggcgcaccgggaacaggtaaaacttcgacggttgtt
cgcattcttgctctgctgcgtgagcagaagtgggggatgaagcagcggatcgccatggcg
gctccaacagggaaggcagcggcaaggctgaaaacatccatcagtgatatcaaacgcact
cttgactgttcagatgaggtgaaatcagcaattcctgacgatgttgtcacgattcatcgc
cttctcggaaccatttcgggttcctcccgctttcgccattcggcaagcaatcctcttcct
tttgataccgttatcattgacgaagcctcaatggttgctctgccactgatgagtctgctg
gtaacagcactcaaagctgacgcacgtcttattcttcttggtgatcacaatcagctcgca
tcggttgaagctggttcggtgtttggagatatttgcagtgcaggatcagataacaatgcc
tcaccactaagcaattcgatggttttgcttgaaaaaaactatcgttttcatcctggcagt
ggtattgctgaaatcagtcgggccgtcaatgaagggctggaaagggaagctgtaagcctt
ctgaaaaggagtaggtcaagcggtgtcacctggcaggagttgcctgcacctgaagagctg
caacatgctctggcaaacaaagcagtcgaaggctttcacagctaccttgatgctgcatcg
cccgctgaggcgctggagcggtttgaccgtttcagaatactctgtgcccttcgcgacggc
ccctatggggtaagtggacttaatcgaacagtcgaaaacatcctcgcccgtaaggctctt
atcagtccggccagcaccttctatcgcggccgtccattgatgattacggtcaacaactat
gcaatgcgtctctttaatggcgacacaggcatacttttccccgatcctgaaaatggaggt
tccctaagagccttttttttcgctccagatggcgaaatccgcagcatcgcaccggagcgg
ctgcctcagcatgaaaccgcatttgccataaccattcacaaaagtcagggctcggagttt
gatcgcctgctgatgcttctgccaccgattgacagtgaaatcctcacaagagaacttata
tacactggtattacaagggcaaaagagagcgttgaaatctgggcgaatgaagaggttttc
tgtgctgcggtaaaaaaacaaacaaaaaggagctctggtttacatttctga

DBGET integrated database retrieval system