KEGG   Pelodictyon phaeoclathratiforme: Ppha_1461Help
Entry
Ppha_1461         CDS       T00731                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppha_1461
   01230 Biosynthesis of amino acids
    Ppha_1461
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppha_1461
   00030 Pentose phosphate pathway
    Ppha_1461
   00051 Fructose and mannose metabolism
    Ppha_1461
   00052 Galactose metabolism
    Ppha_1461
  Energy metabolism
   00680 Methane metabolism
    Ppha_1461
Enzymes [BR:pph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ppha_1461
Protein phosphatases and associated proteins [BR:pph01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ppha_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1536862..1537836)
Genome map
AA seq 324 aa AA seqDB search
MIRKIAVFTSGGDAPGMNAAIRAVTRAAIVNKLKVTGIRRGYQGMIEGDFVALRSSDVSG
ILQLGGTMLQTARSDEFRTAAGREQAYQQLKKAEIDAVVVIGGDGSFTGALVMSQEYNIP
FIGIPATIDNDMYGTDYTIGYETALNSVVEAVDKIRDTARSHGRIFFVEVMGREAGLLAL
TSGIACGAEVILIPESNEQHIELEKFLHKGYKKKETSGIIMVAEGDEAGGAMKIAEKVRN
EHPDLDVRVSILGHIQRGGSPTAKDRVNATRMGVAAIEALLDDQKSMMIGITNEKIVHVP
FNKAVKLNHSIDNNLLDIHKLMNR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatacgaaaaatcgctgtttttacttccggtggtgatgcgccgggaatgaatgctgca
attcgggcagtaacccgtgcagcaatcgtcaacaagcttaaagtcacgggtattcgtcgt
ggttaccaggggatgattgaaggcgattttgttgcactgagatcttctgatgtcagtgga
attcttcagcttggaggaaccatgctgcagacagcacggagtgacgagttcagaactgcg
gcaggtcgtgaacaagcttatcagcaactgaaaaaggccgaaattgatgctgttgttgtt
attggtggcgatggctcttttacgggtgcgctggtgatgtcgcaggaatacaatatccct
tttatcggaattcctgccacaatcgataatgacatgtatgggactgattataccatcgga
tatgaaaccgcattaaattcggttgttgaagctgttgataaaatcagggatacggccaga
tcgcacggacgaattttctttgttgaagtcatgggtcgcgaagcaggtttactcgctttg
accagcggcattgcctgtggagcagaggtcattttgattcccgaatcaaatgagcagcat
attgagcttgaaaaatttctgcataaagggtacaagaaaaaggagaccagcgggattatc
atggttgctgaaggtgatgaagctggcggcgccatgaaaatcgccgaaaaagtacgtaac
gaacaccctgatctggatgtgcgcgtatcaattcttggtcatattcagcgaggaggcagc
ccaacagctaaagaccgggtaaatgctacaagaatgggagttgccgccattgaagccctg
cttgatgatcagaaaagcatgatgataggcatcaccaatgaaaaaattgttcatgtccct
ttcaataaagcggtcaaattaaatcacagcatcgataacaatctgcttgacatccataag
ctgatgaaccgttaa

DBGET integrated database retrieval system