KEGG   Pelodictyon phaeoclathratiforme: Ppha_1653Help
Entry
Ppha_1653         CDS       T00731                                 

Definition
MCP methyltransferase/methylesterase (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pph00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ppha_1653
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ppha_1653
Enzymes [BR:pph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Ppha_1653
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ppha_1653
Two-component system [BR:pph02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Ppha_1653
Bacterial motility proteins [BR:pph02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ppha_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1746059..1749040
Genome map
AA seq 993 aa AA seqDB search
MTKTPASSQKIKASEEHALKSEEKIPFPVVGIGSSAGGLEALELFLKHVPYPCGMAFVII
QHLDPTHKGIMVELLQRETAMPVCQVSDNLEIEPDHVYLIPPNQDMSILHGKLFLLDMVK
PRGLRLPIDFFFRSMADDLKQHSIGVILSGMGSDGTLGLRAIKEKGGGVFVQDPASAKFD
GMPRSAIDEGLADVIVPAENLPSKIIAYVKHLPVILKPALTIEEQALSSLKKIIILFRTQ
TGHDFSLYKKNTIYRRIERRMGIHEIEKISTYVHFLQTNPQEIELLFKELLIGVTSFFRD
PDAWEILKKDGIPSILASRPSGGIIRAWVAGCSTGEEAYSLAIVFREVLATTKHPGNFKL
QIFATDLDKNAIEKARTGIYPSNITADVSAERISQYFEKDDRGYRITRAIRETIVFAPHN
VIMDPPFSKVDILVCRNLLIYMEQELQKKLIPLFHYSLNPGGILFLGSAETIGYCGQLFQ
TLDSKARLFRHMHQAERAEYVDFPASFTHPLHDSSTLPVTQGKPMTSDLNLSTICDKLLL
QYYTPAAVLTNEHGDILYISGRTGNYLEPAAGKANLNIFAMAREGIGYELNILIRNVLRE
KGEISKTGVAVGTNGGTKIIDLTVRLIEKPDSPKNMLMIVFTEVAKKTAENLDQNPVADF
NDRRLASLAEELKQAKEEIITIREEMQTSEEELKSTNEEMQSANEEMQSTNEELTTSKEE
MQSLNEELQTVNHELQSKVTDLSQANNDMKNLLNSTDIATLFLDDELNIRRFTNRTSSII
KLIASDVGRPITDIVTELQYPALLEDAREVLHTLVFSEKQVSASNNRWFSVKIMPYRTQE
NRINGLVITFTDITVAKKLETSLREIEKSFRFVIDTMPVAIIVHQAEGCITMTNQEAERI
TGISMKEMLGKNIADLGWKLLKADGSELPPEENPVVDALRSGKTINGVVIGIIHAQDRKT
RWIKISNSNRLQDEEDKNSHLFTTFFEINNPNS
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacccccgcaagcagccagaaaattaaagcaagtgaagagcatgcactcaag
agtgaagaaaaaattcctttcccggtcgtcggcattggctcttcggccggtggacttgaa
gcgctcgaactgtttctgaagcatgttccttatccctgcggcatggcctttgttatcata
cagcaccttgacccgacgcacaagggaattatggttgaactgcttcagcgggaaacggca
atgcctgtctgccaggtcagcgacaatcttgaaatcgagccggatcatgtctatctgatt
cctccgaaccaggacatgtcgatactgcacgggaaattgtttttacttgacatggtcaaa
ccacgtggtcttcgacttcctattgatttcttttttcgttcaatggccgatgaccttaaa
cagcattccatcggcgtgattctctctggaatgggttccgatggcacacttggactacgc
gccatcaaggaaaaaggtggtggagtatttgtacaggatccagcttccgcgaagtttgac
ggaatgccgcgaagcgctattgacgaaggactggctgacgttatcgtaccagcagaaaat
cttccctcaaaaatcattgcttatgtaaaacatcttcccgtcatcttaaaaccggcctta
accatcgaggagcaggcactgagctcgctgaaaaaaatcattattctgtttcgaacacag
accggacatgatttttcactctacaagaaaaacacgatttatcgccgcatcgaacggcgc
atgggtattcacgaaattgaaaaaatctctacctatgtccattttttacagacgaatccc
caggaaatcgagctgcttttcaaggagctgctgataggggtaaccagctttttccgggat
cctgatgcctgggaaattcttaaaaaagatggcataccctccattctcgcatcccgtcca
tctggcggtattattcgggcctgggtggcaggatgttcaacaggtgaagaggcctattcc
ctcgcgattgtcttcagagaagtccttgcaacaacaaagcatcccggcaatttcaagctc
cagatctttgcaacagacctcgacaaaaatgccattgaaaaagcccgaacaggaatctat
ccatccaatattactgctgatgtttctgcggagcgtatcagtcaatactttgaaaaagat
gaccggggctacagaattacaagagcgattcgcgaaaccattgtctttgctccccataac
gttattatggatccacccttcagcaaggtcgatattctcgtttgccgcaatctgctgatt
tacatggagcaagagctgcagaaaaaactgatcccgttatttcattacagccttaatccc
ggcggaatcctctttcttggaagcgctgaaacaatcggatactgtggccaactgtttcag
actcttgacagcaaggcccgtcttttccgtcatatgcatcaggcagagagggctgagtat
gttgatttccccgcatcttttacccatcctttacacgacagttcaactcttccggtcaca
cagggcaaaccgatgacatccgatctcaacctgagtaccatatgcgataagctcctgctc
cagtattatactcccgcagcagtactgaccaatgagcatggcgacattctctacataagc
ggtcgtacagggaactacctcgaaccagcagcaggaaaagcaaacctgaacatcttcgca
atggcaagggaagggattggctatgagctgaatattctgatcagaaatgtgctccgcgag
aaaggcgagatttccaaaacgggagtggcagtcggaacaaacggaggaacaaaaatcatt
gacctgaccgtcaggttgattgaaaaaccggattcccctaaaaacatgctcatgattgtt
tttaccgaagttgcaaaaaaaacagcagaaaatctggatcagaatcccgttgcagatttc
aatgaccggaggcttgcctcacttgctgaagaactcaaacaagcaaaagaggaaattatc
accatacgtgaagagatgcagacctcggaggaggaactgaaaagcacgaatgaagagatg
cagtcagccaatgaggagatgcagagtaccaatgaagagttaaccacatcaaaagaggag
atgcagtcgctgaacgaagagctgcagacggttaaccatgaactgcaatcaaaagtgact
gacctttcacaggccaacaatgacatgaaaaacctgctgaacagcacggacattgcaaca
ctttttcttgatgatgagctcaacatacgacgcttcaccaaccggacatcatccatcatc
aaactcattgcaagcgatgttggacgtcccataaccgatattgttaccgaactgcaatat
cctgcactgcttgaagatgcccgcgaggttcttcatactcttgttttcagtgaaaaacag
gtttctgcaagtaacaatcggtggtttagcgtcaagatcatgccctatcgaacacaggaa
aaccgtattaacggcctggtaattacctttactgatatcactgtcgccaagaaactcgaa
acaagtctgcgagagattgagaagagtttccgttttgtgattgacaccatgcctgttgcg
attatcgttcatcaggccgaaggatgtattacaatgacaaatcaagaggccgagcgaatt
acaggaatttccatgaaagagatgctcggtaaaaatattgccgatcttggatggaaactg
ctcaaggcagacggctcagaattgcctcccgaggaaaaccctgttgtggacgcattgcgc
tccggcaagacgataaacggagtcgttatcggcattatccacgcccaggatcgcaaaaca
cgatggattaaaatcagtaactcgaacagattacaagatgaagaggacaaaaacagccac
ctctttacaacattttttgaaataaataacccgaattcctga

DBGET integrated database retrieval system