KEGG   Pelodictyon phaeoclathratiforme: Ppha_1700Help
Entry
Ppha_1700         CDS       T00731                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ppha_1700
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ppha_1700
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ppha_1700
Enzymes [BR:pph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Ppha_1700
Exosome [BR:pph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ppha_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1814894..1816366
Genome map
AA seq 490 aa AA seqDB search
MKEWYQKDCMVCTRLKIVLLLIVTVSVSACYFALQTLQAAPKGNAAVPRYIFLFIGDGMG
AAQVELSSALLHDAQSFTMTSLPVLGMATTHAADRFITDSAAAGTALATGWKTTVGTISM
EGNHLDTLRTIAEMAKAKGMKVGIVSSVGIDDATPACFYAHNATRKNVYDIAVQMASSGF
DYFGGGYSVGNFPENQAKTKVFRGDIADLMHSSHYVIARNTTELKAVKPGTPCWAYTDYD
AKGALSFAMDRRNEEIDLAEFTREGIRLLYNPKGFFMMVEGGKIDWACHANDATAAAHDI
KAFEKAIGEAFAFYQRHPGETLLVVTADHECGGLTLGRRANGYETRLDLLHHQNVSQQRF
SEKVSAWKKQGAVTFPMALDSVKVYFGPGNVEADSSLALSEADRNMLQEAYTATMRADFS
GTQHIDAFTPAVSALLNNRAGIGWNSNAHTAVPVQVFAIGRGAEAFTGFYDNTDIANKIM
QIAKLKRPAR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaatggtatcaaaaggattgcatggtatgcacaaggctaaaaattgtactgctg
ctgatcgtcacggtatcggtttcggcctgttattttgcactccagactctgcaggcagct
ccaaagggaaatgccgcagtccctcgctatatctttcttttcataggagatggcatggga
gctgcacaggtggaactctccagcgcactgcttcatgacgctcaatccttcaccatgacc
tctctccccgtactcggcatggcaaccacccatgctgcagaccgctttattaccgattcc
gcagcggctggtacagcgcttgcaaccggctggaaaaccaccgtcggtaccatttccatg
gaagggaaccacctcgatacgctaagaaccattgctgaaatggcaaaagcgaaggggatg
aaagttggtattgtctcaagtgtcggaattgatgacgcaaccccggcatgtttctatgcc
cacaatgccacacgtaaaaacgtatacgatattgccgtccagatggcttcaagcggattc
gactacttcggaggagggtacagtgtcgggaactttcctgaaaaccaggcaaaaaccaaa
gtattcaggggagatatagccgatctcatgcactcttctcactatgttatcgcccgtaac
acaactgaactcaaggctgtaaagccgggaacaccctgctgggcatacaccgattatgat
gccaaaggtgcactgagctttgccatggatcgccgtaacgaagagattgatcttgcagag
tttacccgtgagggtatccggttgctctacaaccccaaaggatttttcatgatggttgaa
ggcggcaaaatcgactgggcctgccatgcaaacgatgccactgccgcagcacacgatatc
aaagcgtttgaaaaagccataggagaggcgtttgctttttaccagcgtcatcccggagaa
acacttcttgtcgtcactgccgatcacgaatgcggtggacttacgcttggccggagagca
aacggatacgaaacccgtcttgaccttctgcaccaccagaatgtttcgcaacagcgattt
tctgaaaaagtctctgcatggaagaagcagggcgccgttacctttcccatggccctcgac
agtgtcaaagtctattttggaccaggaaatgtggaggccgactcatcgctcgccctctct
gaggctgatcgcaacatgctgcaggaggcctacacggcgaccatgagagctgatttttct
ggaacacaacatattgatgcgttcactcccgcagtatcagctttactgaacaatcgggct
ggaattggatggaacagcaacgctcataccgcagtcccggttcaggtgttcgccattggc
cggggcgctgaggctttcacgggcttttacgacaataccgatattgcaaataaaatcatg
cagatcgcaaagctgaagaggcctgcgagatag

DBGET integrated database retrieval system