KEGG   Pelodictyon phaeoclathratiforme: Ppha_1779Help
Entry
Ppha_1779         CDS       T00731                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppha_1779
   01230 Biosynthesis of amino acids
    Ppha_1779
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ppha_1779
   00051 Fructose and mannose metabolism
    Ppha_1779
   00562 Inositol phosphate metabolism
    Ppha_1779
Enzymes [BR:pph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ppha_1779
Exosome [BR:pph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ppha_1779
  Exosomal proteins of bladder cancer cells
   Ppha_1779
  Exosomal proteins of melanoma cells
   Ppha_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1879943..1880698)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVVGNWKMNNSVAESVQLATDVLAALGEGFSGCEVGIAPTYLALDATEKVIAESEV
QLVAQNCHYENDGAFTGEVSARMILAVGCSSVIIGHSERRQYFGETNATVNLRIKKALSE
GLNVILCVGETLAERESGVMETVISSQVREGLDGIIDISAIVIAYEPVWAIGTGKTASSA
QAEEVHLFIRTLVTGLYGQTASEKVRIQYGGSVKPSNAAELFAMPNIDGGLIGGASLNAD
DFAAIVKAASV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaaaattgtagttgggaactggaaaatgaacaacagtgttgccgaatcggtg
cagcttgcaacggatgtgcttgcagcacttggtgagggtttttcgggctgtgaggttggt
atagcgccgacctatcttgcccttgatgctacagaaaaggtgattgcagagagtgaagtt
cagcttgttgcccagaactgccattatgaaaatgatggcgcatttaccggagaggtatcg
gccagaatgatccttgctgttggctgttcttccgttattatcggccattccgagcgtcgt
cagtatttcggcgaaacaaatgctacggtaaatctcaggataaaaaaggccttgtcggaa
gggctgaacgttatcctctgtgttggtgaaacacttgcagaacgcgaatcaggcgtcatg
gaaactgttatctcttcacaggtcagggaagggctcgacggtatcatcgatatcagtgcc
attgtcattgcctatgagccagtctgggctattggtaccggaaaaacagcaagttcagca
caggctgaagaggtgcatctctttattcgcacacttgtcactggactttatggtcagaca
gcctcagagaaagttcgtatccagtatggtggaagtgtcaagccttcaaatgcggccgaa
ctctttgccatgccgaacatcgatggtggtttgattggaggagcgagcctcaatgcagat
gattttgccgcaatcgttaaagctgcttccgtttaa

DBGET integrated database retrieval system