KEGG   Pelodictyon phaeoclathratiforme: Ppha_1794Help
Entry
Ppha_1794         CDS       T00731                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pph00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1894181..1898023)
Genome map
AA seq 1280 aa AA seqDB search
MSNRRKIVAIVGLEQYNAGLWKKIKGLLSSEAELTQLSDVDLEKKHPEAARAIQEADCVF
MSMINFKEQIDWFKKQLDQSSNEKTIFIFESMPEAMALTKVGNYSVGDGKAGMPDMVKKV
AKMLVKGRDEDALYGYMKLMKIMRTILPLVPSKAKDFKNWLMVYSYWMQPTAENIANMFR
LILREYFNEKVTVGAIVDVPNMGIYHPDAPAYFTDVKSYKNWLKKRGINIDKGQKIGLLF
FRKHLLQEKTYIDNTIRVLEKRGIHLFPSFVMGVEGHVLVRDWLVKENIDLLVNMMGFGL
VGGPAGSTKPGTAAEARHEIMTKLDVPYIVAQPLLTQGFESWKELGVSPMQMTFTYAIPE
MDGAICPVILGALQDGKIETVPERIDRLAGVVSQWLRLRATANRDKKVAFIVYDYPPGLG
KKASAALLDVPRTLLAALQRLKKEGYNVGQLPETADALFTALDQATDHQIKQHQPDALKV
NYETFKTLTSSRERERIEERWQKFPGEIVPIGENDVFIGGIRFGNIFVGVQPRIGVQGDP
MRLLFDKANTPHHQYIAFYRWISREFQAHAMVHVGMHGSVEWMPGLQTGLTGDCWPDALL
GEVPHIYIYPVNNPSESTIAKRRGLATMVSHVVPPLSRAGLYKELPALKELLVDFRERNF
SASASASPSGEVDASGFEEAIMQKAELLNLTDDCPRRESEGFTDYVSRLYIYISELENRL
ISNSLHVFGEASPLEAQIITVTETLKNRDEEAKTLPTLLMSASGKNGHFSSYAELTSRSR
KGDEEAIRLREWVDTACRDFVQQVLFDRKNAAGAFSSITGGSRIPADYIPFVEQLMREGS
MLLVALRDNTGELDSLMKVLNGRYISSGPGGDLVRDGINVLPSGRNIHSIDPWRIPSVLA
FKRGTLIADSIVKKHLEENGGEYPETIAQVLWGLDTIKTKGEAVAVVIRLLGGEPSYDAF
GKISHYSLVPLDRLRRPRIDVLMQLSPIFRDAFGLLMDQLDRLVKDAAKADEPVEMNYVK
KHVDEALASGMEFETATARQFTQAPGAYGTYVDDMIEDSAWESENDLDDLFIRRNSSAYG
GGRKGENESAILQKLLGSVDRVVHQVDSTEFGISDIDHYFSSSGSLQLAARRRNTKPGDV
KLNYVESFTSDIKVDDAEKSLRIEYRSKLLNPKWFEGMLKHGHSGAGEISNRVTYMLGWD
AVTKSVDDWVYKKTAETYALDPEMRERLATLNPQAIKNIVGRMLEAHGRGMWKADQNMID
ELQEIYADLEDRLEGLTDDE
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcgccgtaaaattgttgctattgttggtcttgagcagtataacgctggtctc
tggaaaaagatcaaggggcttctttccagcgaagccgaattaacccagttgagtgatgtt
gatcttgaaaaaaagcatcctgaagcggccagggcaattcaggaggcggactgtgttttc
atgagcatgatcaatttcaaggagcagatcgactggttcaagaaacagcttgatcaatcg
agtaacgaaaagaccatctttatttttgagtccatgcctgaagcgatggcattgaccaag
gtagggaattattcggtaggagatggaaaggctggcatgccggatatggttaaaaaagtg
gcgaaaatgctggtgaagggtcgtgatgaggatgccctctatggttatatgaagctcatg
aagatcatgcgcaccattcttccccttgtgccaagcaaagccaaggatttcaagaactgg
ctgatggtttactcctactggatgcagccgacagcagagaatatcgccaatatgttccgg
cttattctgcgggaatattttaacgaaaaggttactgtcggggcgattgttgatgttccg
aatatggggatttatcatcctgatgcaccagcctattttacggatgtcaagagctataaa
aactggttaaaaaagcgtgggatcaatattgacaagggccagaaaattggtcttttattt
tttcgtaaacacctgctgcaggaaaaaacctatatcgataacacgattcgcgtgctcgaa
aaacggggtattcatctgttcccatcctttgtgatgggtgtggagggacatgttctggtg
cgggactggcttgtcaaggaaaatatcgatcttctggttaatatgatgggttttggcctc
gtaggaggccctgccggatcgactaagcctggcacggctgctgaggcgcgtcacgaaatc
atgacaaaacttgacgtcccctacattgttgctcagccacttctgacccagggatttgaa
tcctggaaagagcttggtgtctctcccatgcagatgacctttacctacgccattcctgag
atggatggtgcgatctgtccggttattcttggagcattgcaggatggcaaaatagagacg
gttcctgagcgcattgaccggcttgctggcgttgtcagtcagtggcttcgcttgcgtgca
acggccaacagggataaaaaagttgcgtttattgtctacgattatcctcccggcctcggc
aaaaaagccagtgcggcgctgcttgatgttcccagaacgcttttggccgccttgcaacgg
ttgaaaaaagagggctacaatgttggccagcttcccgaaacggctgatgcgctctttaca
gcccttgatcaggcaaccgatcaccagattaaacagcatcagccggatgccctgaaagtt
aattatgagactttcaaaacgctgacctcctcaagggagcgcgaacgtattgaggagcgg
tggcagaaatttcctggagaaattgtgccgatcggtgaaaacgatgtttttatcggaggc
atacggtttggcaatatttttgtcggtgttcagccacgaattggtgtgcagggcgatccc
atgcgcttgcttttcgacaaggccaatacaccgcaccatcagtatatcgcattctatcgc
tggataagccgggagtttcaggctcacgccatggttcatgtaggaatgcatggatcggtc
gagtggatgccgggacttcagacaggtcttaccggcgattgttggccggatgctcttctt
ggagaggttccgcatatctacatctatccggtgaacaatcccagtgaatccaccattgcc
aagcggcgcggattggctaccatggtttcccatgttgtaccaccgctctctcgtgccggc
ctctacaaggagcttcctgcattgaaagagttgcttgtcgatttccgggagagaaatttt
tcagcttcagcctcagcttctccgagtggggaggtcgatgcttctggttttgaagaggcc
attatgcagaaagctgaactgctcaatctgaccgatgattgtccccgtcgtgagagcgaa
gggttcactgattatgtcagcaggctctatatctatatcagcgaacttgaaaaccggctg
atttccaactcccttcatgttttcggtgaggcgagtcctcttgaagcgcagatcatcacc
gtcacggaaacccttaaaaaccgggatgaagaggcaaaaactctgccgactcttcttatg
agcgcttcggggaagaatggacacttcagcagctatgctgaattgaccagtcgctcaaga
aagggagacgaagaggctatccgcctgcgtgagtgggtcgatacggcgtgccgtgatttt
gtccagcaggtgttgtttgaccgtaaaaatgcagcaggagccttttcttcgataacagga
ggatcgcgcattccggctgattatatcccctttgttgaacagttgatgagggagggctca
atgctccttgttgcgcttcgcgacaataccggtgagcttgattccctgatgaaggtactc
aatggccgttatatctcttccggtccaggaggtgacctggtgcgggacggtatcaatgta
cttccttcgggtcgcaatattcactctatcgatccatggagaattccctcggtacttgct
ttcaagcgggggacgctgattgctgacagtattgttaaaaagcatcttgaggaaaatggt
ggagagtatcctgaaaccatcgcccaggtgctctggggtctcgacaccattaaaaccaag
ggtgaagccgtagccgttgtgatcaggttgctcgggggggagccatcctatgatgctttt
ggtaaaatcagtcactacagtttggtgccgcttgacaggctccgccgtccacggattgat
gtgctcatgcagctcagcccgattttccgtgatgctttcggccttctcatggatcagctc
gaccgacttgtcaaggatgcagccaaagctgatgagcctgtggagatgaactatgttaaa
aaacatgtcgatgaggcgcttgcctctggtatggagtttgagacggcgaccgcccgccag
tttacccaggcgccgggcgcttatggtacctatgttgatgatatgattgaggactcggca
tgggaatcagaaaatgatcttgatgacctctttatccgtcgcaacagtagtgcttacggt
ggaggcaggaaaggggagaatgagtcggctattctgcagaaattgctcggttcggttgac
cgggttgtgcaccaggttgactctaccgaatttggtatctccgatatcgatcattacttc
tcttcttccggttccctgcagcttgccgctcgccgccgcaatacgaaaccaggtgatgtc
aagctcaactacgtagaatcgtttacctccgacatcaaggttgatgatgctgaaaaatcg
ctccgtattgagtaccgttcaaaactgctcaacccgaagtggtttgagggaatgctcaag
catggtcatagcggcgctggtgaaatcagcaaccgcgtcacctacatgcttggctgggat
gccgtaaccaagagcgttgatgactgggtctacaaaaaaacagccgaaacctatgcgctc
gaccctgaaatgagggagcggcttgcaacgcttaatccgcaggcgatcaaaaacattgtc
gggcgaatgcttgaagcgcatggtcgtggcatgtggaaagccgaccagaacatgattgat
gagttgcaggagatctacgccgatctcgaggaccgcctggaaggcctgaccgacgacgag
taa

DBGET integrated database retrieval system