KEGG   Pelodictyon phaeoclathratiforme: Ppha_1914Help
Entry
Ppha_1914         CDS       T00731                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pph00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2004498..2006885)
Genome map
AA seq 795 aa AA seqDB search
MALSPLSSGGPLSVDELQRIDAYWRAANYLSVGQIYLMDNPLLREPLKPEQVKPRLLGHW
GTTPGLNFIYAHLNREICQRDLNVIYLAGPGHGGPAIVANVWLEGTYSEYYPNISEDAAG
MKKMFRQFSFPGGVPSHVAPETPGSIHEGGELGYALSHAFGAVFDNPDLVAACVVGDGEA
ETGPLATSWHSNKFLNPARDGAVLPILHLNGYKIANPAFLARLPHDELESLMIGYGYKPC
FVEGSDPAIMHQKMAAALDNCLDEIAEIQHEARAHGATERPLWPMIVLRSPKGWTGPKEV
DGKKTEDFWRSHQVPFSAVRENPAHLALLEEWMKSYHPEELFTAEGALKPELKELAPKGQ
RRMGDNPHANGGLLLKSLHMPDYREYAVSVSSPGSVRAEATRVMGTFLRDVMKQNEHDSN
FRVFGPDETASNRLGSLFEVTDRTWMESVMPYDESLSRNGRVMEILSEHTCQGWLEGYLL
TGRHGLFSCYEAFIHIIDSMFNQHAKWLKITNDEIPWRRPIASLNYLLTSHVWQQDNNGF
SHQDPGFIDHVVNKKADVIRVYLPPDANTLLSVTDHCLRSRNYINVIVAGKQPAWQWLDM
DAAVRHCTSGIGIWEWASNDAEDGDPDVVMACAGDVPTLETLAAVDILRDKIPDLKIRVV
NVVDLMTLQPSEEHPHGLKDRDFDDIFTTDKPIIFAYHGYPWLIHRLTYRRTNHKNLHVR
GYKEEGTTTTPFDMVVMNDLDRFHLVADVVERVPRLRQRAAYVKQHVRDKLIAHKEYIRK
YGEDMPEIRNWQWTR
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcactctctccactctcttctggcggcccgctatcggttgatgaactgcaacgcatc
gatgcctactggcgtgcggcgaactatctctctgtagggcagatttacctgatggacaat
ccactgctccgggaaccactgaaacctgagcaggtcaagccgcgtttattggggcattgg
ggaacgactccggggctcaattttatttacgctcatctgaatcgtgagatttgccagcgt
gacctgaatgtgatctatcttgccggtccagggcatggcggtcctgctattgtagcaaat
gtctggcttgaaggcacctacagcgagtattatcccaatatttcggaagatgctgcgggt
atgaaaaaaatgttcaggcagttttcttttccaggcggtgttccgagccatgttgcgccc
gaaactcccggttccattcatgaagggggggaactcggttatgcgctttcccatgctttt
ggggcagtttttgataatcctgatctggttgcggcctgtgttgtgggcgatggtgaagct
gaaaccggccctctggctacatcatggcattcaaacaagtttctcaatccggcccgtgat
ggagcggttcttccgattctgcacctgaacgggtataaaattgccaatcccgcttttctt
gcccgtctgccgcacgatgagctggagagcttgatgatcgggtatgggtacaaaccctgt
tttgttgaaggttctgatcctgcaatcatgcaccagaagatggctgccgcactcgataac
tgtttggacgagattgctgaaattcagcacgaagcacgggcgcatggagcaacggaaagg
ccgttgtggcccatgattgtgttgcgttctcccaaagggtggactggcccgaaagaggtt
gatggaaaaaaaactgaagatttctggcgttcccatcaggtgccgttttcagcggtgcgc
gaaaatcctgcccaccttgcgctgcttgaagagtggatgaagagctaccacccggaagag
ctgtttactgccgaaggggcgctgaagccggaactgaaagaacttgcacccaaagggcag
aggcggatgggtgataatcctcatgccaacgggggattgcttttgaagtcgctgcatatg
cctgattaccgggagtatgcggtctcagtgtcctcacctggctctgtcagggctgaggca
acaagggtcatgggtacctttttacgggatgtcatgaagcagaatgagcatgattccaat
ttcagggtattcggccctgatgaaactgcatccaaccggcttggatcgctttttgaagtt
accgaccgcacctggatggaaagcgttatgccctatgacgaaagtctttcccggaacggc
agggttatggagattctttccgagcatacctgccaggggtggcttgagggctatctgcta
acgggtcggcatggtttattttcctgctatgaggcctttatccacatcatcgattcgatg
ttcaatcagcacgcaaagtggctgaagataaccaatgatgaaattccctggcgtcgtccc
atcgcctcgctgaactatctcttgacctcccatgtctggcagcaggacaataacggcttt
tcccatcaggatcccggttttattgatcatgtggtgaacaagaaggctgatgtgattcgg
gtctatcttccccctgatgccaatacgctgctctcggttaccgaccactgtctgcgttcg
cgcaactatatcaatgtgattgttgccggtaaacagcccgcatggcagtggctcgacatg
gatgctgctgtaaggcactgcacgagcggcattggtatatgggagtgggcttcaaacgat
gccgaagatggtgatccggatgtggttatggcctgcgccggggacgttcctacgcttgaa
acgctcgcggctgtcgatattttacgggacaaaatccccgatctcaagattcgtgtggtc
aatgttgttgatctgatgacccttcagcccagcgaagagcaccctcatggactcaaagac
cgggatttcgatgatatttttaccaccgacaagccgatcatttttgcctatcatggttac
ccctggctgattcaccgtctgacttaccggcgtaccaaccataaaaatctgcatgtcagg
ggatacaaggaggagggaacaaccaccacgccgtttgatatggtggtgatgaacgatctt
gaccgctttcatcttgtagccgacgttgtggagcgggttccccgtctcaggcagcgggca
gcttacgtaaagcagcatgtgcgcgacaaactgattgcccacaaggagtatatccgtaaa
tacggcgaggatatgccggaaatcaggaactggcaatggacgcggtaa

DBGET integrated database retrieval system