KEGG   Pelodictyon phaeoclathratiforme: Ppha_1914Help
Entry
Ppha_1914         CDS       T00731                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
pph00030  Pentose phosphate pathway
pph01100  Metabolic pathways
pph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ppha_1914
Enzymes [BR:pph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Ppha_1914
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Ppha_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACF44136
UniProt: B4SC30
Position
complement(2004498..2006885)
Genome map
AA seq 795 aa AA seqDB search
MALSPLSSGGPLSVDELQRIDAYWRAANYLSVGQIYLMDNPLLREPLKPEQVKPRLLGHW
GTTPGLNFIYAHLNREICQRDLNVIYLAGPGHGGPAIVANVWLEGTYSEYYPNISEDAAG
MKKMFRQFSFPGGVPSHVAPETPGSIHEGGELGYALSHAFGAVFDNPDLVAACVVGDGEA
ETGPLATSWHSNKFLNPARDGAVLPILHLNGYKIANPAFLARLPHDELESLMIGYGYKPC
FVEGSDPAIMHQKMAAALDNCLDEIAEIQHEARAHGATERPLWPMIVLRSPKGWTGPKEV
DGKKTEDFWRSHQVPFSAVRENPAHLALLEEWMKSYHPEELFTAEGALKPELKELAPKGQ
RRMGDNPHANGGLLLKSLHMPDYREYAVSVSSPGSVRAEATRVMGTFLRDVMKQNEHDSN
FRVFGPDETASNRLGSLFEVTDRTWMESVMPYDESLSRNGRVMEILSEHTCQGWLEGYLL
TGRHGLFSCYEAFIHIIDSMFNQHAKWLKITNDEIPWRRPIASLNYLLTSHVWQQDNNGF
SHQDPGFIDHVVNKKADVIRVYLPPDANTLLSVTDHCLRSRNYINVIVAGKQPAWQWLDM
DAAVRHCTSGIGIWEWASNDAEDGDPDVVMACAGDVPTLETLAAVDILRDKIPDLKIRVV
NVVDLMTLQPSEEHPHGLKDRDFDDIFTTDKPIIFAYHGYPWLIHRLTYRRTNHKNLHVR
GYKEEGTTTTPFDMVVMNDLDRFHLVADVVERVPRLRQRAAYVKQHVRDKLIAHKEYIRK
YGEDMPEIRNWQWTR
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcactctctccactctcttctggcggcccgctatcggttgatgaactgcaacgcatc
gatgcctactggcgtgcggcgaactatctctctgtagggcagatttacctgatggacaat
ccactgctccgggaaccactgaaacctgagcaggtcaagccgcgtttattggggcattgg
ggaacgactccggggctcaattttatttacgctcatctgaatcgtgagatttgccagcgt
gacctgaatgtgatctatcttgccggtccagggcatggcggtcctgctattgtagcaaat
gtctggcttgaaggcacctacagcgagtattatcccaatatttcggaagatgctgcgggt
atgaaaaaaatgttcaggcagttttcttttccaggcggtgttccgagccatgttgcgccc
gaaactcccggttccattcatgaagggggggaactcggttatgcgctttcccatgctttt
ggggcagtttttgataatcctgatctggttgcggcctgtgttgtgggcgatggtgaagct
gaaaccggccctctggctacatcatggcattcaaacaagtttctcaatccggcccgtgat
ggagcggttcttccgattctgcacctgaacgggtataaaattgccaatcccgcttttctt
gcccgtctgccgcacgatgagctggagagcttgatgatcgggtatgggtacaaaccctgt
tttgttgaaggttctgatcctgcaatcatgcaccagaagatggctgccgcactcgataac
tgtttggacgagattgctgaaattcagcacgaagcacgggcgcatggagcaacggaaagg
ccgttgtggcccatgattgtgttgcgttctcccaaagggtggactggcccgaaagaggtt
gatggaaaaaaaactgaagatttctggcgttcccatcaggtgccgttttcagcggtgcgc
gaaaatcctgcccaccttgcgctgcttgaagagtggatgaagagctaccacccggaagag
ctgtttactgccgaaggggcgctgaagccggaactgaaagaacttgcacccaaagggcag
aggcggatgggtgataatcctcatgccaacgggggattgcttttgaagtcgctgcatatg
cctgattaccgggagtatgcggtctcagtgtcctcacctggctctgtcagggctgaggca
acaagggtcatgggtacctttttacgggatgtcatgaagcagaatgagcatgattccaat
ttcagggtattcggccctgatgaaactgcatccaaccggcttggatcgctttttgaagtt
accgaccgcacctggatggaaagcgttatgccctatgacgaaagtctttcccggaacggc
agggttatggagattctttccgagcatacctgccaggggtggcttgagggctatctgcta
acgggtcggcatggtttattttcctgctatgaggcctttatccacatcatcgattcgatg
ttcaatcagcacgcaaagtggctgaagataaccaatgatgaaattccctggcgtcgtccc
atcgcctcgctgaactatctcttgacctcccatgtctggcagcaggacaataacggcttt
tcccatcaggatcccggttttattgatcatgtggtgaacaagaaggctgatgtgattcgg
gtctatcttccccctgatgccaatacgctgctctcggttaccgaccactgtctgcgttcg
cgcaactatatcaatgtgattgttgccggtaaacagcccgcatggcagtggctcgacatg
gatgctgctgtaaggcactgcacgagcggcattggtatatgggagtgggcttcaaacgat
gccgaagatggtgatccggatgtggttatggcctgcgccggggacgttcctacgcttgaa
acgctcgcggctgtcgatattttacgggacaaaatccccgatctcaagattcgtgtggtc
aatgttgttgatctgatgacccttcagcccagcgaagagcaccctcatggactcaaagac
cgggatttcgatgatatttttaccaccgacaagccgatcatttttgcctatcatggttac
ccctggctgattcaccgtctgacttaccggcgtaccaaccataaaaatctgcatgtcagg
ggatacaaggaggagggaacaaccaccacgccgtttgatatggtggtgatgaacgatctt
gaccgctttcatcttgtagccgacgttgtggagcgggttccccgtctcaggcagcgggca
gcttacgtaaagcagcatgtgcgcgacaaactgattgcccacaaggagtatatccgtaaa
tacggcgaggatatgccggaaatcaggaactggcaatggacgcggtaa

DBGET integrated database retrieval system