KEGG   Pelodictyon phaeoclathratiforme: Ppha_2011Help
Entry
Ppha_2011         CDS       T00731                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ppha_2011
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ppha_2011
  Amino acid metabolism
   00310 Lysine degradation
    Ppha_2011
Enzymes [BR:pph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ppha_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2102093..2103370
Genome map
AA seq 425 aa AA seqDB search
MAIIDVTISQLSESVAEATLLNWKKKPGDGVVEDEILFEIETDKVVFDVPSPASGVLFEI
LVGDGGTVVPNQVLARIDSEGKATVTAQEEAIREARAPEPTAVEAEEVIVMPAAAKLMAE
TGIKLSQVEGTGRQGRVTKGDVLQAIATDAEPSSPQPPPQPVPRPAPTPAPAPAPAQKPK
PVEAHLEAPLMTDRPEQRVPMTRLRARIAERLLQSQASNAILTTFNEVNMQGVIELRNRY
KATFEKEHGVKLGFVSFFVKAAVHALRKYPVLNASVDGKDIIYHGYFDIGIAVSSPRGLV
VPILRNADQMTIADIERKIADYSTKAKLGNLSLEELTGGTFSISNGGVFGSMLSTPIINP
PQSAILGIHATKERAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLGLSAIKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcattgacgtcaccatatcccagttgtcggaatccgttgccgaggcaacgctg
ctgaactggaaaaaaaagcccggagacggcgttgttgaagatgaaatattgtttgaaatt
gaaaccgacaaggtggtcttcgatgttccttcacccgcctctggcgttctctttgaaatt
cttgtcggcgacggaggaacggtggtccccaatcaggtactggcacgaatcgacagcgaa
ggcaaggccacggttaccgctcaggaggaggctatccgcgaggcaagggcacctgaaccg
acagccgtagaagctgaagaggtcatcgtcatgcctgcagcggcaaaactgatggccgaa
accggaataaagctctcacaggttgagggtacaggacgacagggacgagtgaccaaaggc
gacgtactgcaggccattgcgacagatgctgaaccctcttcgccacaaccacctcctcag
cccgtgcccaggcctgcaccaacacctgcgcccgcacccgcacccgcacagaagcccaaa
ccggtagaggcacaccttgaagcgccgctgatgaccgatcgaccggaacagcgcgtccca
atgacccgtctcagggcacgcattgccgagcggctgcttcagtcgcaggccagcaacgcc
attctcacgaccttcaatgaggtcaacatgcagggtgtgatcgaattgcgcaaccgctat
aaggccacctttgaaaaagagcacggcgtaaagctcggatttgtctccttttttgtcaaa
gctgcggtgcacgctttgcgcaaatatccggttctcaatgcatcggtcgatggcaaggat
atcatctatcatggctacttcgacattggtattgccgtcagctctcccagaggacttgtg
gtacccattctgcgcaatgccgaccagatgaccattgccgatattgaacgaaaaatcgct
gactactccaccaaagcaaagctcggcaacctctccctcgaagagctgaccggcggcacc
ttctccatttccaacggcggcgttttcggttcgatgctttcaactcccatcatcaatcca
ccccagtcggccattctcggcattcatgccacaaaagagagagctgtagtggaaaacggc
cagatcgtcatacggccaatgaactatctggccatgtcgtacgatcacagaatcatcgac
ggccgcgaagctgtccttggcctcagtgcaatcaaggatgcgctggaagatccggcacgt
ctcttacttgatctttaa

DBGET integrated database retrieval system