KEGG   Pelodictyon phaeoclathratiforme: Ppha_2055Help
Entry
Ppha_2055         CDS       T00731                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
pph00240  Pyrimidine metabolism
pph00250  Alanine, aspartate and glutamate metabolism
pph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ppha_2055
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ppha_2055
Enzymes [BR:pph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Ppha_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACF44262
UniProt: B4SCQ7
Position
2146414..2147349
Genome map
AA seq 311 aa AA seqDB search
MSDLKHLTGLCNIPASNITSILDMAAGYKKKLITPCPSFEPSLQNKRIALVFFENSTRTR
FSFEIAARHLGAGTLNFSASSSSVSKGESLSDTIKNLEAMQVDAFVLRHPSSGAADLITR
ITSKNVINAGDGSHEHPTQALLDMFTLREYFGTIDGLKVIIIGDVLHSRVARSNIYGLIT
AGAEVGICCPVTLMPPDADQLGITLFTDLDRAIAWADTAIVLRLQLERATGGYLPSLEEY
SVHYGLTDERLERVQKHLLVLHPGPINREIEIANNVADRIQPPGYSKSMLLEQVTNGVAV
RMAVLNTLLTL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatttgaagcaccttactggattatgcaatattccggccagcaacatcaccagc
atccttgatatggctgccggttataaaaagaagttgatcaccccctgcccctcttttgaa
ccatcccttcagaataaacgcattgcactggttttttttgaaaactcaacccgtacccga
ttttcttttgagatagcagcacgacaccttggcgcaggcacgctgaacttcagtgcatcg
tcaagcagtgtcagcaagggggaaagcctgagtgataccatcaaaaatcttgaggccatg
caggtggatgcctttgttcttcgtcatccctcttccggagctgcagatctcataaccaga
ataacctcaaaaaacgtgatcaatgccggagacggatcgcatgagcatccgacacaggcg
ttgctcgacatgtttacgctccgcgaatattttggaacaattgatgggctcaaagtgatc
attattggcgatgtgctgcatagcagggtcgcccgttcaaacatttacggcctcatcact
gccggcgccgaggttggtatctgctgcccggtcaccctcatgcctcccgatgctgaccag
cttggcatcactctctttaccgaccttgaccgtgccattgcctgggccgatacagcaatc
gtgcttcgactgcaacttgaacgagctacgggaggatacctgccctcgctggaagagtat
tctgtccattatggtctgaccgatgagcgccttgaacgggtacagaaacatctgctggta
cttcatcccggcccgataaaccgggaaattgaaatagcaaacaatgtggccgaccgcata
cagcctccgggctattcaaaaagcatgctgcttgaacaggtaactaacggagtcgctgtc
cgcatggcagtgctgaacaccctgctaaccctgtaa

DBGET integrated database retrieval system