KEGG   Pelodictyon phaeoclathratiforme: Ppha_2562Help
Entry
Ppha_2562         CDS       T00731                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
pph  Pelodictyon phaeoclathratiforme
Brite
Enzymes [BR:pph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Ppha_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2629599..2630777)
Genome map
AA seq 392 aa AA seqDB search
MKAPYFARNRCSAYSHHSAITIRSCRIAKIEENNSREILIFANSEALAVVYIFAAGLFFY
FHRFMPNSSIVITGATGYIGSQILLALLARFPGERRCRVIARKSSDCSFLESLPVEIVRA
DMLDPLALLEAFRGAETVFHCAGLISYTRHSRNALYEANVVGTRNVVNASLHHKVRRLVL
TSSIAAIGASEDGSPASESSTFQEWQRRNGYMESKHLAELEGLRGVAEGLEVVMVNPGVV
IGVDRRNPASVSSSNEVLRLVYQGKLPFFPSGGTGFVDVRDVADAHLAAWEKGRSGERYV
VVGSNLTFRELFARIGTLSGSSSGRAFMVPDALGLLAGLGGELWSMLSNRPSFISLESIR
IASRILAFSNTRSEQELGLCYRELSETLKTLL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctccttattttgcccggaatcgttgttctgcctacagccatcattccgccatc
accatccgttcttgccgcattgcgaaaatagaagaaaacaatagccgcgaaattcttatt
tttgcgaacagtgaagctctcgctgttgtttacatctttgcagccgggctctttttttat
tttcaccgtttcatgcctaactcatcaattgtcataaccggggctaccggatatatcggt
tcccagattcttcttgcgctgcttgcacgctttcccggagagcgtcgctgcagggtgatt
gcccggaaaagctcggattgctcttttctggagagcttgcctgtcgagattgttcgggcg
gatatgcttgatcctcttgcccttcttgaggctttcaggggagcggaaacggtctttcat
tgtgcgggacttatctcctataccagacactcccgaaatgcgctctatgaggccaatgtg
gtcgggacaagaaatgtggtcaatgcctccctgcaccataaggtgcgcaggcttgttttg
accagctccattgccgccatcggcgcctccgaggatggttcgccagccagtgagtcatcc
acctttcaggagtggcagcgacggaatggttatatggagtcgaagcatcttgctgaactt
gaggggctgcgcggagttgcagagggccttgaagtggtcatggttaatcctggtgtggtt
attggtgttgaccgccggaatcccgcttcggtcagttcttcgaacgaggtattgcgcctt
gtctatcagggaaagctgcccttcttcccttcgggaggcaccggttttgttgatgtccgc
gatgtcgctgatgctcacctggcggcttgggaaaaagggcgttcaggggagcgttatgtt
gtggttggcagcaatctgaccttccgggagctttttgcccgcatagggactctttctggc
agcagcagtggccgggcatttatggtgccggatgctcttggtctgcttgccggtcttggc
ggagagctttggtcgatgctctcgaaccgtccctcctttatcagcctcgagagcattcgt
atcgcctcaaggattcttgcgttcagtaatacccgctcagagcaggagcttggtttgtgt
taccgcgagctgtccgaaacgctcaagactctgctctga

DBGET integrated database retrieval system