KEGG   Pelodictyon phaeoclathratiforme: Ppha_2569Help
Entry
Ppha_2569         CDS       T00731                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pph00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2636109..2636636
Genome map
AA seq 175 aa AA seqDB search
MPMHKVFIGIGSNIGERLHHLQEAVDRIALLAGTEVRGVSAIYMTEPVGESEQNRFFNGV
VELETSLAPEELRRQCKTIEQELGRPDAYPRWSPRVIDLDILLYDDLSLLTETLTIPHPE
LHCRNFVLIPLLDLANPLHPAMHKTILQLLSGCSDRSVLIKLKEGIRIKKRRNAR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgcacaaggtctttatcgggataggatccaatattggagagcgcctccaccac
cttcaggaggccgttgaccggattgcccttcttgccggaacagaggtgagaggcgtctca
gcaatctatatgaccgaaccagtcggcgagagcgaacagaaccgcttctttaacggggta
gttgaacttgaaacatcacttgcacccgaagagctgcgccgacaatgtaaaacaattgag
caggaacttggaagaccggatgcctatccgcgctggagcccgagagtcattgacctcgac
attctgctctacgacgacctctctctcctcaccgaaacactcaccataccgcaccccgaa
ttgcattgtcgcaactttgtccttatccctctgctcgaccttgccaatcccctgcatccc
gcaatgcacaagaccattctgcagctactctccggctgcagcgaccgctcggtattgata
aaattaaaagagggaatcaggataaaaaaaagacggaatgcccggtaa

DBGET integrated database retrieval system