KEGG   Pelodictyon phaeoclathratiforme: Ppha_2581Help
Entry
Ppha_2581         CDS       T00731                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ppha_2581
Enzymes [BR:pph01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ppha_2581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2649962..2653765
Genome map
AA seq 1267 aa AA seqDB search
MHDKIRIAAIVGMEQCNQRVWREVTAKIAAHAELTQWTDQDLEHQNPEAAEAIRNADCIF
TTLIQFKGQADWLQEQIEQSKVKTIFAYESMPEVMQMTKIGNYVVSGDGSGMPDIVKKVA
KMLVKGRDEDALYGYMKLLKIMRTMLPLIPKKAKDFKNWMQVYTYWMNPTTDNLASMFNY
IIAEYFEVEVKVEKVQEVPTMGFYHPDAPEYQKDLHHYEKWLHKRNKNSAKQRNIGMLFF
RKHLLQEKEYIDNAIRAIEAKGLNPLPVFVMGVEGHVAAREWFTHNNIDMLVNMMGFGFV
GGPAGATTPGASSAARDEILGKINAPYVVSQPLFIQDFASWKSQGVIPLQSAMTYSLPEM
DGAVCPVVLGAIKDGRLQTVPDRLERLAGFAKKFSDLRQVPNRDKKVALVVYDYPPGMGK
KASAALLDVPKSIYNIITTLRSEGYDVGELPESPEALLAMLDKATDYEIQAHEQECFAID
REVFNSITSSRERERIEGRWSGFPGDIAPIKPDKLFIGGITLGNIFIGVQPRLGIQGDPM
RLLFDKENTPHHQYIAFYRWISRIFQANALVHIGMHGTAEWMPGLQLGVTGDCWSDALLG
EVPHFYIYPINNPSEANIAKRRGYATMISHNIPPLARAGLYKELPAFKEMLNDYRERGLE
KMVDVETEEVIITKAEQLNLTDDCPRVEGESFPDYISRLYTYMMELEGRLISNSLHVFGE
TPKLETQVTTITEYLKVRGNEKSLPSIIMQAIGEDNTYGDYATLATRARKGEPQALKTRE
TVDEHTRAFIEKSIFGQTNPATVFSTMTGGGKATKEMAEAINSALQDGVALKRALEDNRN
EMKGFLRALCGEYIPSGSGGDLVRDGAGILPTGRNIHAIDPWRIPSELAFKRGKQIADSI
LSRHVEENNGQYPETIAQVLWGLDTIKSKGEAVAVIIHLMGAEPAYDAQGKISHYRLVPL
EKLGRPRIDVLIQISSIFRDTFGVLVDHLDKLVKEAAKAIEPHEMNHIKKHVDAALKEGK
DFESATSRLFTQAPGAYGSQVEELVEDSAWESEEDLDNMFIKRTGFAYGGNRYGDQQTDI
LKGLLSTVDRVVQQVDSAEFGITDIDRYFSSSGALQLSARRRNPKGDNVKLNYVETFTAD
VKIDDADKALKVEFRSKLLNPKWFETMLDQGHSGAAEISNRFTYMLGWDAVTKGVDDWVY
KEAAETYAMDPKMRERLMKVNPKAFKNIVGRMLEASGRGMWSADPDMIEKLQEIYSDLED
RLEGIEI
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgcacgataaaatcagaattgccgctattgtcgggatggagcaatgcaaccagcgggta
tggcgcgaggtgactgcaaaaatcgcggcacatgcagaattgacccaatggaccgatcag
gatctcgaacatcagaaccctgaggctgccgaagccatccgcaatgccgactgtattttt
accaccctgatccagttcaagggacaggcagactggctgcaggagcagatcgaacaatcg
aaggtgaagactatctttgcctatgagtcgatgccggaagtcatgcagatgaccaaaata
ggcaattacgtggtctcgggagatggcagcggcatgcccgatattgtcaagaaagttgca
aaaatgctggtgaaagggcgcgacgaggatgcgctctacggctacatgaagctgctgaaa
atcatgcgcaccatgttgccgctgatccccaaaaaggcaaaggacttcaagaactggatg
caggtctacacctactggatgaacccgaccaccgacaatctggcatcgatgttcaactac
atcatagccgaatacttcgaagttgaggtcaaagtcgagaaggtgcaggaggtgccaacc
atgggcttctaccacccggatgctccggaataccagaaagatctgcaccattacgaaaaa
tggctccacaaacgcaataaaaattcagcaaaacagcgtaacatcgggatgctctttttc
cgcaaacacctgctgcaggaaaaagagtatatcgacaatgccatccgggccatcgaagcc
aagggtctcaaccccctgccggtctttgtaatgggtgttgaaggccacgttgccgccaga
gagtggtttacacacaacaacatcgacatgctcgtcaacatgatgggcttcggttttgtg
ggcggccctgcaggagcaaccacaccaggcgcatcatcagccgcacgtgacgagattctg
gggaaaatcaacgccccctacgttgtctcccagccgctctttatccaggatttcgcatca
tggaaatcgcaaggtgttatcccgcttcagtcagccatgacctactcgctgcctgaaatg
gacggcgccgtctgcccggttgtactcggagccatcaaggatgggcgactgcaaaccgtt
ccggatcgccttgaaaggctggccggttttgccaaaaaattttccgaccttcgccaggta
cccaaccgcgataaaaaagttgccctcgtcgtctacgactatcctccaggcatgggcaaa
aaagccagcgccgccctgcttgatgtaccaaaaagcatttacaacatcatcacaacgcta
cgctccgaagggtatgatgtcggcgaactgccggaatcacctgaagcgctgctggccatg
ctcgacaaggcaaccgattacgaaatccaggcacatgaacaggagtgctttgccattgac
cgtgaagtgttcaacagcatcaccagctcaagagagcgcgagcgcattgaaggacgctgg
agcggcttcccgggcgacattgcgccaatcaagcccgacaagctctttatcggcggcatc
accctcggcaatatctttatcggcgttcagccgcgccttggcatacagggtgaccccatg
cgcctcctcttcgacaaagagaacacaccgcaccatcagtacatcgccttctaccgctgg
atcagccgcatcttccaggcaaacgccctggtgcacatcggcatgcacggcacggcagaa
tggatgcccggccttcagctcggcgtcaccggcgactgctggtcagacgcactgctcggt
gaagtgccccacttctatatctacccgatcaacaacccgagcgaagccaatattgccaaa
cgccgcggctacgccaccatgatttcgcacaacatccccccactcgcacgggcaggactc
tacaaagagcttccagccttcaaggagatgctgaacgactaccgcgaacgcggacttgaa
aagatggtggatgtagagaccgaagaggttatcatcaccaaagcagagcagctcaacctt
accgatgactgccctcgtgttgagggagagagcttcccggactatatcagccgcctctat
acctacatgatggagcttgaaggacgcctgatttcaaactcgctgcacgtctttggcgaa
acaccgaaactggaaacccaggtcaccaccatcaccgagtacctcaaggtgcgcggcaac
gaaaaatcactgccatcaatcatcatgcaggccatcggtgaagataacacctatggcgat
tatgccactctggccacccgtgcccgcaagggagaaccacaagcccttaaaacacgggaa
acggttgacgaacataccagagcctttatcgaaaagagtattttcggccagaccaatccg
gcaaccgtattcagcaccatgaccggtggcggaaaggcgacaaaggagatggcagaggcc
atcaacagcgcactgcaggatggtgtagccctgaaacgcgcactcgaagacaaccgcaac
gaaatgaagggattccttcgtgccctttgcggcgagtacattccctcaggctccggcggc
gatctggtgcgtgacggagcaggtattctgccaaccggacgcaacattcacgccatcgac
ccctggcgcatcccttcagaactggccttcaaacgcggcaaacagattgccgacagcatc
ctcagccgtcacgtagaggagaacaacggccagtacccggagaccattgcacaggtactc
tggggtctcgataccatcaagagcaaaggtgaagccgttgccgtcatcatccacctcatg
ggcgccgaaccagcctacgacgcacagggcaaaatcagccactaccgcctcgtaccgctt
gaaaaacttggtcgcccaagaattgatgtcttgatccagatcagctccatcttccgcgac
acctttggagtgctcgtcgatcatctcgacaaactggtcaaggaggctgcaaaagccatt
gagccgcacgagatgaaccatatcaaaaagcatgtggacgcagccctgaaagagggaaaa
gatttcgaaagcgccacatcgcgactcttcacccaggcacccggagcatacggctcacag
gtcgaagagctggtggaagattcagcatgggagtcggaagaggatctcgacaacatgttc
atcaaacgcaccggctttgcctatggcggcaaccgctacggcgaccagcagaccgatatc
ctcaaagggctcctcagcaccgttgaccgcgtcgtacagcaggtcgattcggctgagttc
ggcattaccgatattgatcgctacttctcctcttcaggagcgctgcaactctcggcacga
cgccgcaacccgaaaggggacaatgtcaaactcaactacgtcgagacctttacagccgat
gtgaagattgacgatgccgacaaagcgctgaaagtagagttccgcagcaaactgctcaac
ccgaaatggttcgaaaccatgctcgaccaggggcacagcggagccgctgaaatcagcaac
cgcttcacctacatgcttggctgggacgccgtcaccaaaggtgttgacgactgggtttac
aaagaggctgccgaaacctatgccatggatccgaagatgcgtgagcgactcatgaaggtc
aatccgaaggccttcaaaaacatcgtcgggcgtatgctcgaagcaagcggacgcggcatg
tggagcgccgaccccgacatgatcgaaaaactgcaggagatctattcagacctcgaagac
cgccttgaaggcatcgagatttaa

DBGET integrated database retrieval system