KEGG   Pelodictyon phaeoclathratiforme: Ppha_2615Help
Entry
Ppha_2615         CDS       T00731                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ppha_2615
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ppha_2615
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ppha_2615
Enzymes [BR:pph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ppha_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2704395..2705768
Genome map
AA seq 457 aa AA seqDB search
MSSEFTKILLNEDEMPRQWYNIQADLPVPLPPPLGPDGNPIGPDALAKVFPMNLIEQEMS
TERWIDIPQEIQAILKIWRPSPLYRAHRLEAALKTPAKIFYKNEGVSPAGSHKPNTAVAQ
AWYNKEFGIKHLITETGAGQWGSALAMSCKLVGIDCKVFMVRISFDQKPFRKIMMKTWGA
DCIASPSTETAVGRRILAAMPDTPGSLAIAISEAIEQAVEHDDTRYALGSVLNHVMLHQT
IIGLEARKQLDKVGLYPDIVIGCAGGGSNFAGISFPFICDKIHGREVQVIATEPEACPTL
TRGPYVYDNGDEAQMTPLLAMHSLGHGFIPPAIHAGGLRYHGMAPLVSHVKQLGLIEATS
LGQTECYEAAMLFAHTEGFIPAPETAHAIAQTIREAKKATEEGKEKVILMNWSGHGLMDL
QGYDAFMSGKLSDYALPEELLQRSLLAVKDHPPAPQA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggaattcacgaagatcctgctgaacgaggatgagatgcctcgccaatggtac
aatattcaggctgacctgcctgttccgctgccgccacctttggggccggatgggaatccg
ataggccctgacgcccttgcaaaggtttttccgatgaaccttattgagcaggagatgagc
acggaacggtggatcgatattccgcaggagattcaggctatcctgaaaatctggcgtccc
tctccactctaccgggcccaccgacttgaggccgcattaaaaactccggcaaagattttt
tacaaaaacgaaggggtctctccggcagggagtcacaaacccaataccgccgtggcacag
gcctggtacaacaaggaatttggcatcaagcatctcatcacggaaaccggcgcgggtcag
tggggaagcgcacttgccatgagctgcaagcttgtcggtatcgactgcaaggtctttatg
gtacgtatcagcttcgatcagaagccgttccgcaaaatcatgatgaaaacctggggagcc
gactgtattgcaagccccagcacagagactgctgttggacgcaggattcttgccgccatg
cccgatacaccgggaagccttgccattgccatcagcgaagctatcgagcaggctgtcgag
catgatgacacgcgttatgcacttggcagcgttttaaaccacgtgatgctgcaccagacc
attatcggccttgaggcccgcaaacagctcgacaaggtggggctttatcccgatatcgtc
atcggttgtgccggcggaggctcaaactttgccggaataagctttccgtttatttgtgac
aagattcatggccgtgaggttcaggtgattgcaacagagcctgaagcctgcccgacgctc
accagaggcccctatgtttacgataacggcgatgaggctcaaatgacaccgctgctggcg
atgcacagcctcggccacggctttattcctccagcgattcatgccggggggttacgctat
cacggcatggccccgctggtcagccatgtcaagcagcttggattaattgaggcgacctcc
cttggccagactgaatgttatgaggcagccatgcttttcgcccatactgaggggttcata
cctgctccggaaacagcacatgctatagcccagaccatccgcgaagccaaaaaagcaacc
gaggaaggaaaggagaaggttattctcatgaactggtcgggtcatggattgatggatctg
cagggttatgacgctttcatgtccggaaaactgagtgattacgcacttcctgaagagctc
ctgcagcgctcacttcttgcagtgaaagatcatccgcctgctccgcaagcgtaa

DBGET integrated database retrieval system