KEGG   Pelodictyon phaeoclathratiforme: Ppha_2707Help
Entry
Ppha_2707         CDS       T00731                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ppha_2707
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ppha_2707
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ppha_2707
Enzymes [BR:pph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ppha_2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2800917..2802233
Genome map
AA seq 438 aa AA seqDB search
MIYFSTNKSSIPVSIKKATLEGLAPDGGLYIPAEIPRFSPEEITLLDGASFNNIAFAIAN
KFIGGAIPPDQLSDIIDNCYTFDTPIVQLDRNTFVEELFCGPTLAFKDYGARFLARLTGY
FAAEEQKLITVLVATSGDTGSAVAYGFQGIANTRVVLLYPSGKVSRLQEQQLTTAGGNVH
ALEVQGDFDDCQRMVKQAFVDPDLNKSLTLTSANSINISRLIPQSFYYAWATLQLKERYD
CHDPLFSVPSGNYGNLTAGVLAKRMGFPIGHFIAASNANDSVTRYIDEGRYDPHPTITTL
STAMDVGNPSNFARLRYFYHNDHTSMGQDITGIAISDEETVAAIRSAHERFGYIMDPHTA
VAFRALERFRSSAIHGEKPGILLSTAHPAKFLEAIESALGKEIGIPSNLQELMGKKKCAT
LISSEYKELASFLNGLDQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatctatttcagcaccaataaatcatcaatacccgtctccattaaaaaggctacgctt
gaagggcttgctcccgatggtggcctctatatccctgctgaaattccccgcttttcgcca
gaggagataacacttctcgatggggccagttttaacaatatcgcttttgccattgcaaac
aagtttatcggaggcgctatcccccccgaccagcttagcgacatcattgacaattgctat
acctttgacactccgattgtccagctcgaccgaaatacctttgttgaggagcttttctgc
ggaccaacacttgccttcaaggattacggtgcacgttttctcgcccgattgaccggctat
tttgctgcagaagagcagaagcttattaccgtccttgttgcaacatctggagatacggga
agtgcagtggcatatggatttcagggcattgcaaacacacgggtcgtgctgctctaccct
tcaggaaaagtgagccgccttcaggagcagcaactcaccactgcaggaggcaatgttcat
gcgcttgaagtacagggcgattttgacgattgccagcgaatggttaaacaggcatttgtt
gatcccgacctgaataaatcgctgacactcacctcggccaactccatcaatatatcacga
ctgattccccagtcattctattatgcctgggcaaccctgcagctcaaggaacggtacgac
tgccatgaccctctcttttccgtcccgagcggcaactacggaaacctcaccgcaggtgtg
cttgcaaaacggatgggctttcccataggccactttattgcagcatcaaacgccaatgac
agcgtaacccgctatatcgatgagggacgctacgacccgcacccgaccatcacaaccctg
tcgacggcaatggacgtcggcaacccgagcaactttgcacgactcagatatttctaccat
aacgaccacacatccatggggcaggatatcacgggtattgccatttcggatgaagagact
gttgccgcaatccgatcggcccatgagcgcttcggctatatcatggatccgcataccgcc
gtcgcgttccgtgctcttgaacgcttcagaagctcggcaatccatggtgaaaaacccggc
atcctcctctcaaccgctcatccagcaaaatttcttgaagcaatagagagtgccctgggt
aaagagatcggtatcccctcgaatcttcaggagctgatgggaaaaaagaaatgtgccacc
ttgatcagttcagagtataaagagcttgcctcttttctcaacggactcgaccagtaa

DBGET integrated database retrieval system