KEGG   Pelodictyon phaeoclathratiforme: Ppha_2707Help
Entry
Ppha_2707         CDS       T00731                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pph01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pph00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pph00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2800917..2802233
Genome map
AA seq 438 aa AA seqDB search
MIYFSTNKSSIPVSIKKATLEGLAPDGGLYIPAEIPRFSPEEITLLDGASFNNIAFAIAN
KFIGGAIPPDQLSDIIDNCYTFDTPIVQLDRNTFVEELFCGPTLAFKDYGARFLARLTGY
FAAEEQKLITVLVATSGDTGSAVAYGFQGIANTRVVLLYPSGKVSRLQEQQLTTAGGNVH
ALEVQGDFDDCQRMVKQAFVDPDLNKSLTLTSANSINISRLIPQSFYYAWATLQLKERYD
CHDPLFSVPSGNYGNLTAGVLAKRMGFPIGHFIAASNANDSVTRYIDEGRYDPHPTITTL
STAMDVGNPSNFARLRYFYHNDHTSMGQDITGIAISDEETVAAIRSAHERFGYIMDPHTA
VAFRALERFRSSAIHGEKPGILLSTAHPAKFLEAIESALGKEIGIPSNLQELMGKKKCAT
LISSEYKELASFLNGLDQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatctatttcagcaccaataaatcatcaatacccgtctccattaaaaaggctacgctt
gaagggcttgctcccgatggtggcctctatatccctgctgaaattccccgcttttcgcca
gaggagataacacttctcgatggggccagttttaacaatatcgcttttgccattgcaaac
aagtttatcggaggcgctatcccccccgaccagcttagcgacatcattgacaattgctat
acctttgacactccgattgtccagctcgaccgaaatacctttgttgaggagcttttctgc
ggaccaacacttgccttcaaggattacggtgcacgttttctcgcccgattgaccggctat
tttgctgcagaagagcagaagcttattaccgtccttgttgcaacatctggagatacggga
agtgcagtggcatatggatttcagggcattgcaaacacacgggtcgtgctgctctaccct
tcaggaaaagtgagccgccttcaggagcagcaactcaccactgcaggaggcaatgttcat
gcgcttgaagtacagggcgattttgacgattgccagcgaatggttaaacaggcatttgtt
gatcccgacctgaataaatcgctgacactcacctcggccaactccatcaatatatcacga
ctgattccccagtcattctattatgcctgggcaaccctgcagctcaaggaacggtacgac
tgccatgaccctctcttttccgtcccgagcggcaactacggaaacctcaccgcaggtgtg
cttgcaaaacggatgggctttcccataggccactttattgcagcatcaaacgccaatgac
agcgtaacccgctatatcgatgagggacgctacgacccgcacccgaccatcacaaccctg
tcgacggcaatggacgtcggcaacccgagcaactttgcacgactcagatatttctaccat
aacgaccacacatccatggggcaggatatcacgggtattgccatttcggatgaagagact
gttgccgcaatccgatcggcccatgagcgcttcggctatatcatggatccgcataccgcc
gtcgcgttccgtgctcttgaacgcttcagaagctcggcaatccatggtgaaaaacccggc
atcctcctctcaaccgctcatccagcaaaatttcttgaagcaatagagagtgccctgggt
aaagagatcggtatcccctcgaatcttcaggagctgatgggaaaaaagaaatgtgccacc
ttgatcagttcagagtataaagagcttgcctcttttctcaacggactcgaccagtaa

DBGET integrated database retrieval system