KEGG   Pelodictyon phaeoclathratiforme: Ppha_2813Help
Entry
Ppha_2813         CDS       T00731                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pph00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pph00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2901106..2902233
Genome map
AA seq 375 aa AA seqDB search
MNNRSRVLLASLLLLLLFRMTAYSATQPDSTSLKIGQMLMIGFRGFSVADAPEIRADIRE
RQIGGVVLFDYDVPSHSTSRNISSPEQLARLTMELQELSQIPLLIAIDQEGGKVSRLKPA
RGFPSSVSAEHLGALNNPDSTRAATRQCAKTLKAMHIGMNLSPVADLNVNPDNPVIGKLG
RSFSSDPAVVTGNISIICSLFRDEGIIPALKHFPGHGSSTTDTHRDFTDITASWSEKELE
PYHALIAAGYHDPIMTAHVFNGKLDPLYPATLSKAILDGVLRTRLGFDGVIVSDDLQMKA
IADHYGLETAIRLAIEAGVDLLLFGNNTSYDPAIASKAAAIMHSLLQKKLITEERIDRSY
RRIMDLKERYLFKCK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatagatcacgggtgctgctggcatcgttgctgctcctgcttctctttcgcatg
acagcatacagtgcaacacagcccgacagcacctctctgaaaatcggccagatgctcatg
atcggcttccgggggttcagcgttgctgatgctccggagattcgggctgatatcagggag
cgccagataggaggagtcgtgctcttcgactacgatgtgccatcccattccacgtcaagg
aacatcagcagtccggagcaactcgcccgcctgacaatggagctgcaggagttgtcgcaa
attccgctcctgattgccatagaccaggagggaggaaaggtcagccgcctcaagccagcc
aggggatttccctccagtgtttcggcggagcatctgggagcgctcaacaaccccgacagc
accagagctgcaacccggcaatgtgcaaaaacgctgaaagcaatgcacatcggcatgaat
ctttcgcctgtcgctgacctgaacgtcaatcctgacaatccggttatcggcaaacttggt
cgaagcttctcatccgaccctgcagtggtgacgggaaacatcagcatcatttgcagcctc
ttccgggacgagggcattattcccgcactgaaacatttccccggtcacggcagttcaacc
accgacacgcatcgtgattttaccgacattacagcaagctggtcagaaaaagagctggag
ccctaccatgcccttatcgccgcaggctatcatgacccaatcatgaccgcacatgtcttc
aatggaaaactcgaccccctctacccggcaacactctcaaaagcgatcctcgacggagtg
ctccgcacccgactcggcttcgatggagtgattgtgagcgacgacttgcagatgaaagcc
attgccgaccattacggccttgaaacggccatccgcttggccattgaggctggtgttgac
ctgctgctctttggaaacaataccagctacgatccggcaattgcctcgaaagccgcagca
atcatgcattcgctactgcagaaaaagctcattacagaggagcgtatcgaccgctcatac
cgaagaatcatggatctcaaagaacgctatctcttcaaatgcaaatga

DBGET integrated database retrieval system