KEGG   Pelodictyon phaeoclathratiforme: Ppha_2855Help
Entry
Ppha_2855         CDS       T00731                                 

Definition
(GenBank) Esterase/lipase-like protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
pph  Pelodictyon phaeoclathratiforme
Brite
Enzymes [BR:pph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Ppha_2855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Ser_hydrolase LIDHydrolase PGAP1 Esterase Ndr Abhydrolase_3 DUF3530 Peptidase_S9 Abhydrolase_5 Abhydrolase_2 BAAT_C LCAT DUF900
Motif
Other DBs
NCBI-ProteinID: ACF45001
UniProt: B4SH13
Position
complement(2944326..2945246)
Genome map
AA seq 306 aa AA seqDB search
MKYLFCIGSVFYLDEFLKNSQFKGIFPIPHYIQREPFYNLYSQIVSESIMELQHRERSPF
GVLIIHGFTATLDSVKSLYTSIEKLGIPVRQPLLAGHGALSPEALRGVRWESWMADAEQA
LFELSLEVEQVIVIGHSMGALLSLNLAARHKEKIDSLVLVAPAIQLISVLAPGRPLHFAA
PFVSKIIKNWKLKSDFADQGCATCIPHYSWVPTDAIISFFELIKISQQLLGRVNVPVLIV
HNRRENTVRPESALILYNRIATEPSGKSIIWLEHSGHQIFCDCENEKAVKAIMDYVASRI
RQRVHG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatctcttttgcatcggttcagttttttacctggatgagttcctgaaaaatagc
caattcaagggaattttccctataccccattatattcagcgagagccgttttataatttg
tacagccagattgtatcagagtcgattatggagttacaacacagagagcgaagccctttt
ggagtccttattattcatggttttacggcgacgcttgatagtgtgaaatcgttgtacacc
tctattgaaaaacttggtattccggtcaggcagcctctgctggcggggcatggtgcattg
tcccctgaggcgctccgtggtgtacgatgggagtcgtggatggcggatgctgagcaggcg
cttttcgaactgagccttgaggttgagcaggttatcgtgatcggccatagtatgggagcg
cttctctcgctcaatcttgcagcaaggcacaaggagaagattgattctctggtgcttgtt
gctccggcgattcagctcatttctgtgcttgctccaggtcgtcctcttcattttgccgcg
ccatttgtgagcaaaattatcaaaaattggaagttgaagagcgattttgcggatcagggc
tgtgcaacctgcattcctcattattcctgggtgccaacagatgccatcatctcttttttt
gagctgataaaaataagccagcaactgcttgggcgggtcaatgtgcccgttttaattgtg
cataaccgcagggaaaatacggttcgtcctgaaagcgcccttatcctttacaacaggatt
gctactgagccatcaggcaagtctattatctggctggagcattccggtcaccagatcttt
tgtgattgtgagaatgaaaaagccgtcaaggcgattatggactatgtggcttcaagaatc
cgacagagggtgcacgggtga

DBGET integrated database retrieval system