KEGG   Pelodictyon phaeoclathratiforme: Ppha_2898Help
Entry
Ppha_2898         CDS       T00731                                 

Definition
bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
pph  Pelodictyon phaeoclathratiforme
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pph00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ppha_2898
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ppha_2898
Enzymes [BR:pph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     Ppha_2898
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Ppha_2898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2982670..2985687)
Genome map
AA seq 1005 aa AA seqDB search
MTVSSDGSNLQEVQLEELLKEISSLELLGKAGFGGAISMVTSDSREVLPGSLFVAIKGYA
TDGGRFIRSAVERGAAAVICEEFPSDPALPCLYIKVADARKALAEAARIFYGKASDQLLI
IGVTGTNGKTTTAKLITAMLNANGISAGYIGTNMCRIGELEIPLDRTTPEAHGLHALFRQ
MLEAGCKAAVMEVSSHALVLQRVYGIRFHAALFTNLTQEHLDFHETMHDYAEAKQQLFDQ
LSPDGFAVLNIDDPYAEQMAARVADDKIYCCTMQRGLQPALSCSRLFAADLLQGTLASST
IVLHFPDESVEMQVKLPGNFNVMNVLEAAAIGTGMALSAKEICNALSAVSTVEGRMERVG
ESRQGWMAFVDYAHTPDALFKALDALHGLKEDASRLIVVFGCGGNRDKEKRSEMGRIASE
IADEVIITSDNPRDEDPEEILDAIERGITGVHYLRISDRAEAIRRAVLMLKAGDLLLVAG
KGHEKYQEIAGHKYFFSDQAIIKTAMQENVSGYPEKERVQLNRKGVLTIDDFRKVGEVVE
AGRGHGDSLPPSQPPQEMVSPVVVIDSREVRGGELFIALKGENADGHCFIGTVFEKGASW
AMVSRQWYEEQGSVDPPPGKGFIVTDDTVAGLQQLATIYRHQFSIPVLAIGGSNGKTTTK
EMVASVLGTGFRVHMSEGNRNNHLGVPLTLLQLRGDTDIAVVEMGINHPGEMVLLAAIGS
PTHALLTNIGHEHLEFLVDLDGVEAAEIPLFDYLRQSGGIAFVNMDDPRISAAASGMAGS
VPYGMATRSEHSCWARDISVNSAGALSFLLCSIAGSEPVTLNFTGKHNVMNAIAAATVGH
YFGLSLCQIREGLERLTPAPGWKRLEVLDACGVRILNDTYNANSDSMRKAIDALCDLPGA
GKRVAVLGDMLELGLAGEVEHQAIGNYLQQSSVDLLFTFGESARLFGRAVPERYRGHFES
REALLEALRTVLQEGDIVLFKGSRGMKLEQVVDALINAKTITGRE
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgacggtatcaagtgatggttccaacctgcaggaggtgcaactggaggagttgctcaag
gaaatttcctctctggagcttctgggaaaagctggctttgggggggcgatcagcatggtt
accagtgattcccgtgaggtacttcccggatcgcttttcgttgcgataaaaggctatgct
accgatggaggtcgctttatccgcagtgcagttgagcgaggggctgcagcggtgatctgc
gaagaatttccctctgatcctgctcttccctgtctctatatcaaggtcgctgatgcgcga
aaagctctggcggaggctgctcggattttttatggaaaagcttctgatcagttgctgatt
atcggagttaccggaaccaacggcaaaaccacgacagcaaagctgattacggccatgctg
aatgccaatggtatttctgctggttatatcgggacgaatatgtgcaggattggagaactc
gaaattccgctggatcgtaccactccggaggctcatggccttcatgcgcttttccgtcag
atgctggaagcgggatgcaaggctgccgtgatggaggtctcctctcatgcactggtgttg
cagagggtctatggtatccggtttcatgcggcgctctttaccaacctgacccaggagcat
cttgactttcatgaaaccatgcacgattatgcggaagccaagcagcaactgttcgatcag
ctttcgccggacgggtttgcggtgctgaatattgatgatccttatgccgaacaaatggcg
gctcgtgtagcagatgataaaatatattgttgtaccatgcagcgggggcttcagccagcg
ctctcgtgcagcaggctctttgcagcagatcttcttcagggtacccttgcctcaagtacc
attgtgcttcattttcccgatgagtcagtggagatgcaggttaagcttccgggaaacttc
aatgtcatgaatgtgcttgaagctgcggccattggaacgggcatggctctctctgccaaa
gagatatgcaatgctctttctgcggtttcgacggtggaggggcgcatggaaagagttggt
gagagccgtcaggggtggatggcctttgttgattatgcgcatactccggatgcccttttc
aaggcgcttgatgccttgcatggcctcaaggaggatgcttcccgccttatcgtggttttt
gggtgtggaggaaacagagacaaggaaaagcgttctgaaatggggcggattgcttcagaa
attgccgatgaggttattattacctctgacaatcctcgggatgaagatccggaggagatt
cttgatgcaatcgagcgtggtatcaccggggttcattacctgaggatcagtgacagggct
gaagccatccggcgggcggttctgatgctcaaggcgggagatctccttcttgtggcggga
aaagggcatgaaaagtatcaggagatagccggccacaaatattttttttcagatcaggcg
atcataaaaacagctatgcaggaaaatgtttccggatatccggaaaaggagagagtacaa
ctgaacaggaaaggcgtgctgacgattgatgattttcggaaggttggagaggtggtcgag
gccggaagagggcatggcgactctctgccgccttcgcagcctccgcaggagatggtttct
cccgttgtggttatcgattcaagagaggtgagagggggagagctttttattgccctgaaa
ggtgaaaatgcagatggtcattgctttattggcactgtttttgaaaagggtgcctcctgg
gcgatggtgagtcgtcagtggtatgaggagcagggctctgttgatccgccaccaggaaaa
ggatttattgtgacggatgatacggttgcagggctgcagcagcttgcaacgatctaccgc
caccagttttcgattcccgttctggctattggcggcagcaatggaaaaacaacaaccaag
gagatggtggcctcggtacttggaaccggtttcagggttcatatgagtgagggcaacagg
aacaaccatcttggggttcctttgaccctgttgcaactgagaggtgacaccgatattgct
gttgtcgagatgggtatcaatcatccgggtgagatggttttgcttgcggctatcggcagc
ccaacccatgctctcctgacgaatattggccatgagcatcttgagtttcttgttgatctt
gatggtgttgaggcggcggagataccgcttttcgattatcttcgccagagcggaggtatt
gcgtttgtcaatatggatgatccgaggatcagcgcggcagcctcggggatggctggaagt
gttccctatggaatggcaacacgttcggaacactcctgttgggccagggatatttcggta
aacagtgcaggcgcactctcttttcttctctgttccattgccggttcagaaccggtaacg
ttgaattttacaggaaaacataatgtcatgaatgccattgcggcggctacagttggtcac
tatttcggtctctcgctctgccagatccgcgagggtcttgagcgtctcactcctgctcca
ggctggaaacggcttgaggttcttgatgcctgtggagtgagaatccttaatgacacctat
aatgccaattcagactccatgcgcaaggcgattgatgcgctttgtgatcttcccggcgca
ggcaaaagagtggccgttctgggcgatatgcttgagcttggattggcgggagaggttgag
catcaggcaattggcaactatcttcagcagagttcagttgatctgctctttacctttggt
gagagtgcacggctttttggccgggcagttcccgaacgttacaggggccatttcgaaagc
cgcgaagcgcttcttgaagcattacggacggtactgcaggagggagatatcgtgcttttt
aagggatcaagaggaatgaaacttgagcaggttgtcgatgcgcttatcaatgcaaaaacc
ataaccgggcgagaatag

DBGET integrated database retrieval system