KEGG   Pseudomonas putida ND6: YSA_00304Help
Entry
YSA_00304         CDS       T02170                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppi  Pseudomonas putida ND6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(157316..158434)
Genome map
AA seq 372 aa AA seqDB search
MMMRQMLVGLVALGLPVFANAGSVCPWPAWERFKAELVSVDGRVIDPSDERLITTSEGQS
YALFFALVGNDRQTFAQLLRWTSNNLAEGDLARHLPAWLWGRDGQQQWQVLDANNASDAD
LWIAYSLLEAGRLWDQPAYTQLGQHLLWRIAAQTVRKLPGLGVMLLPGDYGFEDAQGTRL
NPSYLPLQLLDRFSEVDPLWGELAANTRRLWLASSPKGFAPDWLLWTPAGKPAADTKHGN
AGDYDAIRVYLWVGMLAKGAAQRRELVAHYAPMAALTQRQGLPPEHLDARSGEARGHGPA
GFSAALLPLLAASPEHVAGLAAQRQRLREQPVEAKAYYSQVLALFGQGFDEARYRFDPHG
RLLPAWSAPCSE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgatgatgcgtcagatgctggtagggctggtcgccttaggcctgcccgtcttcgccaat
gccgggtcggtttgcccatggcctgcctgggagcggttcaaggccgagctggtgagtgtg
gatgggcgggtcatcgacccgagtgacgagcgcctgatcaccacctcggaagggcagagt
tacgcgctgttcttcgccctggtaggtaacgaccggcaaaccttcgcgcagttgctgcgt
tggaccagcaacaacctcgccgagggtgacctggcccggcatctgcctgcctggctgtgg
ggccgtgacgggcagcagcagtggcaggtgctggacgccaacaacgccagcgatgccgat
ctgtggatcgcctacagcctgctggaagcagggcggttgtgggaccagccggcctacacg
cagctgggccagcacctgctgtggcgtatcgccgcgcagaccgtgcgcaagcttccaggc
cttggcgtgatgttgctgccaggtgactacggcttcgaagacgcccagggtacccgcctg
aaccccagctacctgccgctgcagctgctcgaccgcttcagcgaggtggaccccttgtgg
ggtgagctggcggccaacacgcggcgtttgtggttggcatcgtcgccaaagggctttgcc
ccggactggttgctgtggacgccggccggaaagccagcggcagacacgaaacatggcaat
gccggtgattatgacgccattcgtgtgtacctgtgggtcggcatgttggccaagggggcg
gcgcaacgccgcgaactggtcgcccattatgcgccgatggcggcattgacccagcgccag
gggctacctcctgagcacctggatgcacgcagcggtgaagcccgcggccatggcccggca
ggtttctctgcggccttgctgccattgcttgctgcctcgccagagcacgtggccggcctg
gcggcccagcgccagcgcttgcgcgaacaaccggtcgaggccaaggcgtattacagccag
gtgctggcgctgttcggccagggcttcgacgaggcccgttaccgttttgacccgcacggc
cgcctgttgccggcctggagtgcgccatgcagcgaatga

DBGET integrated database retrieval system