KEGG   Pseudomonas putida ND6: YSA_00922Help
Entry
YSA_00922         CDS       T02170                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppi  Pseudomonas putida ND6
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YSA_00922
Enzymes [BR:ppi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YSA_00922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(454690..455598)
Genome map
AA seq 302 aa AA seqDB search
MNAKVVVVGSLNMDLVVRAQRLPRAGETLPGDSFFTVPGGKGANQAVAVARLGGSVAMIG
NVGDDDYGRQLHRALYVEGIDCQGVSTCPGTSSGVALITVDAASQNCIVIIPGANGLLTP
QSVLRFDALLQAAEVVICQLEVPTGTVACTLARARELGKQVILNPAPATGPLPADWFAHI
DYLTPNESEAEALTGVAVTDQDSARRAGERLLQLGAGKVIITLGAQGALLVTAQGHQHYP
APRVQPLDTTAAGDTFIGGFAAGLVRGLEEGEAIAFGQRAAALSVTRAGAQPSIPYLAEL
TP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaaggttgtggtggtcggcagcctcaacatggacctggtggtccgcgcccag
cgcctgccccgggccggcgaaacactccccggcgatagctttttcacggtgccgggcggc
aagggtgccaaccaggcggtggcggtagcgcggctggggggcagcgtggcgatgatcggc
aatgtgggggatgatgactacgggcggcaactgcaccgggccttgtatgtcgagggtatc
gactgtcagggtgtcagcacctgcccgggcacgtccagcggtgtggcgctgatcacggtg
gatgctgccagccagaactgtattgtcatcattcccggcgccaacggcctgctgacgccg
cagtcggtgctgcgtttcgatgcactgctgcaggccgccgaggtggtcatctgccagctg
gaagtgcccactggcactgtggcttgcacactggccagggcgcgtgagctgggcaagcag
gtcatcctgaacccagcacccgctaccggccccttgccagcggactggtttgcgcatatc
gattaccttacccctaacgaaagcgaggccgaagccttgaccggtgtggcggtgaccgac
caggacagtgcccggcgcgcaggcgagcgcttgctgcagctgggggcaggcaaagtgatc
atcaccttgggtgcgcaaggtgccttgctggttactgcccaaggccatcagcactatccg
gcgccgcgcgtgcaaccgctggacaccaccgctgccggcgataccttcattggtggcttt
gctgccggcctggtgcgtgggctggaggagggggaggcgatcgcctttggccagcgtgcc
gcggcattgtcggttacccgtgccggtgcccaaccgtcgattccctacctggcggagctg
acgccatga

DBGET integrated database retrieval system