KEGG   Pseudomonas putida ND6: YSA_01193Help
Entry
YSA_01193         CDS       T02170                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppi  Pseudomonas putida ND6
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YSA_01193
Enzymes [BR:ppi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YSA_01193
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YSA_01193
Lipid biosynthesis proteins [BR:ppi01004]
 Fatty acid synthase
  Component type
   YSA_01193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(614456..615073)
Genome map
AA seq 205 aa AA seqDB search
MENPMRVWWLSAGLALYCLAQSAAAGTLLVVGDSISAGFGLDSRQGWVSLLQARLRDEGF
DDKVVNASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQPPAQLQQNLASMIE
RSRQAGAKVLLLGMRLPPNYGVRYTTAFAKVYEQLAADKQVPLVPFFLEGVGGVPELMQA
DGIHPAQGAQQRLLENAWPAIKPLL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggagaatccgatgcgagtgtggtggttgagtgccggtctggccctgtattgcctggcc
cagagcgcagcggcaggaacactgctggttgttggcgatagtatcagcgccggttttggc
ctggatagccgtcagggctgggtgtctctcttgcaggcccgtctcagggacgaaggtttt
gacgacaaagtggtcaatgcttcgatcagtggcgatacgagcgcaggtggccaggcgcgg
ctcccggcgctgcttgcagcacataaaccaagcctggtggtgctggagctgggcggcaac
gatggcctgcgcgggcagccgcctgcacaattgcaacaaaatcttgcctcgatgatcgag
cgttcgcgtcaggcaggggccaaggtgctgctattgggcatgcgcctgccgcccaattat
ggtgtgcgttacaccaccgcctttgccaaggtgtatgaacagctggcagcggacaaacag
gttcccttggtgccgtttttcctcgaaggggtagggggcgtacctgaactgatgcaggct
gatggcatccatccggcccagggggctcagcagcgcctgctggaaaatgcctggccagcg
ataaaacccttgctgtga

DBGET integrated database retrieval system