KEGG   Pseudomonas putida ND6: YSA_01349Help
Entry
YSA_01349         CDS       T02170                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppi  Pseudomonas putida ND6
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ppi01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppi00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ppi00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ppi00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ppi00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ppi00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:ppi00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ppi00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ppi00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:ppi00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:ppi00281]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:ppi00362]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ppi00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:ppi00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(693159..693932)
Genome map
AA seq 257 aa AA seqDB search
MAFETILLDIHGKVGLITLNRPQALNALNAQIVGEINQALDQLERDPNIGCVVLTGSAKA
FAAGADIKEMAELQYPQIYVDDLFSDADRIANRRKPIIAAVSGFALGGGCELAMMCDFIL
AADNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMELCLTGRLMGAEEAERAGLVARIV
PQAELVEEALKVAATIASKSIPVSMMVKESVNRAFEVTLSEGVRFERRVFHAAFSTEDQK
EGMAAFIAKREAQFKDR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaaccatcctgttggacatccacggcaaggtcggcctgatcaccctcaac
cgcccgcaggcgctcaatgcgctgaacgcgcagattgtcggtgagatcaaccaggccttg
gaccagcttgagcgcgacccgaacatcggctgcgtggtgctgacaggctcggccaaagcc
tttgccgctggcgccgacatcaaggaaatggctgagctgcaatacccgcagatctacgtc
gacgacctgttcagcgacgccgaccgcattgccaatcgccgtaagccgatcattgctgcc
gtgtctggatttgccctgggcggcggctgtgagttggcgatgatgtgcgactttatcctc
gctgcggacaatgccaaatttggtcaaccggaaatcaacctgggcgtgctgccgggcatg
ggcggcacccagcggctgacgcgtgcggtgggcaaggcgaaggccatggagctttgcctg
accggccgcctgatgggggcggaagaagccgagcgagcaggtttggtggcgcggatcgtg
ccgcaggcagagctggtggaagaggcgctgaaggtggcggcgaccattgccagcaagtcg
attccggtgagcatgatggtcaaggagagcgtcaaccgagcatttgaagtcaccctcagc
gagggggttcgttttgagcgtcgggtcttccatgcggcgttctccaccgaagaccagaaa
gaaggcatggccgcattcatcgccaagcgtgaggcacagttcaaggaccgttga

DBGET integrated database retrieval system