KEGG   Pseudomonas putida ND6: YSA_01486Help
Entry
YSA_01486         CDS       T02170                                 

Definition
NagZ
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppi  Pseudomonas putida ND6
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YSA_01486
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    YSA_01486
Enzymes [BR:ppi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YSA_01486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(775906..776916)
Genome map
AA seq 336 aa AA seqDB search
MTVSLQGSLMVDIAGKWLTAEDRQLLRQPEVAGLIIFARNIDSPRQVRELCASIRAIRPE
LILAVDQEGGRVQRLRQGFVRLPAMRALADNDNAEYLAEQCGWLMATEVLAVGLDLSFAP
VLDLDHQRSAVVGSRAFEGDPLRATRLAGAFIRGMNAAGMAACGKHFPGHGWAEADSHVA
IPTDERSLEQLRQADLVPFTRLSGQLAAVMPAHVIYPQVDNQPAGFSRRWLQDILRGELG
FDGVIFSDDLSMAGAHVVGDAASRIEAALSAGCDMGLVCNDRAAAELALSAAQRMKVKPS
PRIARMRGQGFARTDYRQQPRWLEALGALKEAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcagcctgcaaggctccctgatggtggatatcgccggtaaatggctgaccgcc
gaagaccgtcaactgcttcgccagccggaagtggctggcctgatcatcttcgcccgcaat
atcgacagcccgcgccaggtgcgcgaactgtgcgcgtccatccgcgccattcgccccgag
ctgatcctggcagtggatcaggaaggtggtcgcgtacagcgtctgcgccagggctttgtg
cgcctgccggccatgcgtgcgctggccgataacgacaatgctgaatacctggctgaacag
tgcggctggctgatggcgaccgaggtactggcagttggcctggacctcagcttcgctccg
gtgctcgacctggaccaccagcgtagcgccgtggtgggcagccgcgccttcgagggtgac
ccgctgcgtgcaacgcgactggccggcgcgttcatccgaggcatgaatgcggcaggtatg
gccgcgtgtggcaagcatttcccggggcatggctgggccgaagccgattcgcacgtggcc
atccccaccgatgagcgcagcctggaacaactgcgccaggccgacctggtgccgtttacc
cgcctgagtgggcagctggcggcagtgatgccggcgcatgtcatctacccgcaggttgac
aaccagcccgctggcttctcgcggcgttggttgcaggacatcctgcgtggcgagctgggc
tttgatggggtgattttcagtgatgacctgtcgatggccggtgcgcatgtggtgggcgac
gcggccagccgtatcgaggcggcgctgagcgccggttgtgatatgggcctggtgtgcaat
gaccgggcggcggcggagctggcgctgagtgcggcgcagcgcatgaaggtcaagccatcg
ccgcggattgcccggatgcgtgggcaagggtttgcgcggaccgattatcgccagcagccg
cgctggctggaggcgttgggggcgttgaaggaagctcagctggtcgattga

DBGET integrated database retrieval system