KEGG   Pseudomonas putida ND6: YSA_01712Help
Entry
YSA_01712         CDS       T02170                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ppi  Pseudomonas putida ND6
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YSA_01712
Enzymes [BR:ppi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     YSA_01712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
908279..909061
Genome map
AA seq 260 aa AA seqDB search
MTTTMHTPKDQLVKLAQQQMLTALTDNTYTVRQKLALTCRILFDGGHDSGLAGQITARAQ
EPGTYYTQQLGLGFDEIAASNLLVVDEDLTVLQGRGMANPANRFHSWLYRARPDVNCIIH
THPLHSAALSMLEVPLAISHMDLCPLFDDCAFLKEWPGVPVGNEEGEIIANAIGDKRAIL
LSHHGLLIAGRSIEEACVLALLFERAAKMQLLAMGAGDIRPIPEALGKEAHDWISTPKRH
GAAFSYYARRALRAHGDCLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccatgcacacccccaaggaccagcttgtcaaactcgcccagcaacagatg
ctgacggcgctgaccgacaacacctacaccgtacgacaaaagctcgccctcacctgtcgc
atcctgttcgacggcggccacgactctggcctggccgggcagatcactgcgcgtgcgcag
gaacctggcacctactacacccaacaactggggcttggcttcgacgaaatcgctgcctcc
aacctgctggtggtggacgaagacctgacggtgctgcaaggccgtggcatggccaacccg
gccaaccgcttccacagctggctgtaccgcgcccgccccgacgtcaactgcatcatccac
acccacccgctgcacagcgccgccttgtcgatgctggaagttccgctggccatctcgcac
atggacctgtgcccactgttcgacgactgtgcattcctcaaggaatggcccggtgtgccg
gtgggcaacgaagaaggcgaaatcatcgcgaacgcgattggcgacaagcgcgcaatcctg
ctttcccatcatggcctgctgatcgctgggcgttcgatcgaggaagcctgcgtgctcgcc
ctgctgttcgagcgggcagcaaagatgcaactgctggccatgggcgccggtgacatccgc
cccatccccgaagcactgggcaaagaggcccacgactggatttccacccccaaacgtcac
ggtgctgccttcagctactacgcgcgccgtgccttgcgtgcccatggcgactgcctgggc
tga

DBGET integrated database retrieval system