KEGG   Pseudomonas putida ND6: YSA_02010Help
Entry
YSA_02010         CDS       T02170                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppi  Pseudomonas putida ND6
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    YSA_02010
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YSA_02010
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YSA_02010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1080214..1080702)
Genome map
AA seq 162 aa AA seqDB search
MAATMLNIPCVTLSGEHKTLGDFPGKVLLVVNTASQCGFTPQYKGLEQLWQAYRDRGLVV
LGFPCNQFGKQEPGDARDIAQFCERNFGVSFPLFRKVEVNGPGAHPLFVELKQRAPGILG
SQKIKWNFTKFLVDPASGQVKRYAPSTKPQALQADIERLLSR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacgatgctgaacatcccctgtgtgaccctgagtggcgagcacaagacgctg
ggcgacttcccgggcaaggtgctgttggtggtcaataccgccagccagtgcggttttacc
ccgcagtacaagggcctggagcaactgtggcaggcctaccgcgaccgtggcctggtggta
ctgggtttcccgtgcaaccagttcggcaagcaggaacctggcgatgcgcgggacattgcg
cagttctgcgagcgtaatttcggcgtgagttttccgctgtttcgcaaggtcgaggtcaac
ggcccaggcgctcaccctctgttcgtcgaactcaagcaacgcgccccgggtattttgggt
agccagaagatcaagtggaacttcaccaagtttctggtcgacccggccagtggccaggtc
aagcgctatgccccctccaccaagccacaggccctgcaggcggacatcgagcgtttgctc
agccgctga

DBGET integrated database retrieval system