KEGG   Pseudomonas putida ND6: YSA_02010Help
Entry
YSA_02010         CDS       T02170                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppi  Pseudomonas putida ND6
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ppi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1080214..1080702)
Genome map
AA seq 162 aa AA seqDB search
MAATMLNIPCVTLSGEHKTLGDFPGKVLLVVNTASQCGFTPQYKGLEQLWQAYRDRGLVV
LGFPCNQFGKQEPGDARDIAQFCERNFGVSFPLFRKVEVNGPGAHPLFVELKQRAPGILG
SQKIKWNFTKFLVDPASGQVKRYAPSTKPQALQADIERLLSR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacgatgctgaacatcccctgtgtgaccctgagtggcgagcacaagacgctg
ggcgacttcccgggcaaggtgctgttggtggtcaataccgccagccagtgcggttttacc
ccgcagtacaagggcctggagcaactgtggcaggcctaccgcgaccgtggcctggtggta
ctgggtttcccgtgcaaccagttcggcaagcaggaacctggcgatgcgcgggacattgcg
cagttctgcgagcgtaatttcggcgtgagttttccgctgtttcgcaaggtcgaggtcaac
ggcccaggcgctcaccctctgttcgtcgaactcaagcaacgcgccccgggtattttgggt
agccagaagatcaagtggaacttcaccaagtttctggtcgacccggccagtggccaggtc
aagcgctatgccccctccaccaagccacaggccctgcaggcggacatcgagcgtttgctc
agccgctga

DBGET integrated database retrieval system