KEGG   Pseudomonas putida ND6: YSA_02012Help
Entry
YSA_02012         CDS       T02170                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ppi  Pseudomonas putida ND6
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    YSA_02012
   01230 Biosynthesis of amino acids
    YSA_02012
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YSA_02012
   00290 Valine, leucine and isoleucine biosynthesis
    YSA_02012
Enzymes [BR:ppi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     YSA_02012
    2.6.1.66  valine---pyruvate transaminase
     YSA_02012
Amino acid related enzymes [BR:ppi01007]
 Aminotransferase (transaminase)
  Class I
   YSA_02012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081192..1082490
Genome map
AA seq 432 aa AA seqDB search
MPGVQSGTRFLPFQTFRRGVARFLNRDPIMQFSKSNKLANVCYDIRGPVLKHAKRLEEEG
HRILKLNIGNPAPFGFEAPDEILQDVIRNLPTAQGYSDSKGLFSARKAVMQYCQQKEIEG
VTIEDIYLGNGVSELIVMSMQALLNNGDEVLIPAPDYPLWTAAVSLAGGKPVHYLCDEQA
DWFPDLEDIKAKITPNTKALVIINPNNPTGAVYSKELLLGMLELARQHNLVVFSDEIYDK
ILYDEAVHISTASLAPDLLCLTFNGLSKSYRVAGFRSGWLIISGPKHHAHSYIEGIDMLA
NMRLCANVPAQHAIQTALGGYQSINDLVLPPGRLLEQRNRTYELLNDIPGVSCVKPMGAL
YAFPRIDPKVCPILNDEKFALDLLLSEKLLIVQGTAFNWPWPDHFRVVTLPRVDDLEAAI
GRIGNFLKGYSQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgccaggcgttcagtctggcacccgcttcctgccctttcaaacctttcggcggggcgta
gcgcgttttctcaatcgggatcccatcatgcagttcagcaaatcgaacaagctcgccaat
gtctgctacgacattcgcggcccagtgctcaagcacgccaaacgcctggaggaggaaggc
caccgcatcctcaagctgaacatcggcaacccggcgccgtttggcttcgaggcgcctgat
gaaatccttcaggatgtgatccgcaacctgcccaccgcacagggctacagcgactccaaa
ggcctgttcagtgcccgcaaggcggtgatgcagtactgccagcagaaagaaatcgaaggc
gtcaccatcgaggacatctacctgggtaatggtgtgtccgagctgatcgtcatgtcgatg
caggcgctgctcaacaacggcgacgaagtgctgatcccggcccccgactacccgctgtgg
acagccgccgtgagcctggccggcggcaagccggtgcactacctgtgcgacgagcaggcc
gactggttccctgaccttgaggacatcaaggccaagatcaccccaaacaccaaggcgctg
gtgatcatcaacccgaacaacccgaccggcgccgtctactccaaagagctgctgctgggc
atgctggagctggcgcgccagcacaacctggtggtgttctccgacgagatctacgacaag
atcctgtacgacgaagctgtgcacatcagcaccgcctcgctggccccggacctgctgtgc
ctgaccttcaacggcttgtccaagtcataccgggtggcgggcttccgctctggctggctg
atcatttccgggcccaagcaccacgcacacagctacatcgaaggcatcgacatgctggcc
aacatgcgcctgtgcgccaacgtgccggcccagcatgccatccagaccgcgctgggcggc
taccagagcatcaacgacctggtgctgccaccggggcgcctgctggagcagcgcaaccgc
acctacgaactgctcaacgacatccccggcgtcagctgcgtgaagccgatgggcgcgctg
tatgcattcccgcggatcgacccgaaggtttgcccgatcctcaacgacgagaagttcgcc
cttgacctgttgctgtcggagaagctgctgatcgtacaaggaacggcgttcaactggccg
tggccggaccacttccgcgtggtgaccttgccgcgggtggacgacctggaagcagccatt
ggccggatcggcaatttcctgaagggttattcgcagtag

DBGET integrated database retrieval system