KEGG   Pseudomonas putida ND6: YSA_02012Help
Entry
YSA_02012         CDS       T02170                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00220  Arginine biosynthesis
ppi00250  Alanine, aspartate and glutamate metabolism
ppi00290  Valine, leucine and isoleucine biosynthesis
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01130  Biosynthesis of antibiotics
ppi01210  2-Oxocarboxylic acid metabolism
ppi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YSA_02012
   00290 Valine, leucine and isoleucine biosynthesis
    YSA_02012
   00220 Arginine biosynthesis
    YSA_02012
Enzymes [BR:ppi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     YSA_02012
    2.6.1.66  valine---pyruvate transaminase
     YSA_02012
Amino acid related enzymes [BR:ppi01007]
 Aminotransferase (transaminase)
  Class I
   YSA_02012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFK67856
UniProt: I3UQT5
Position
1081192..1082490
Genome map
AA seq 432 aa AA seqDB search
MPGVQSGTRFLPFQTFRRGVARFLNRDPIMQFSKSNKLANVCYDIRGPVLKHAKRLEEEG
HRILKLNIGNPAPFGFEAPDEILQDVIRNLPTAQGYSDSKGLFSARKAVMQYCQQKEIEG
VTIEDIYLGNGVSELIVMSMQALLNNGDEVLIPAPDYPLWTAAVSLAGGKPVHYLCDEQA
DWFPDLEDIKAKITPNTKALVIINPNNPTGAVYSKELLLGMLELARQHNLVVFSDEIYDK
ILYDEAVHISTASLAPDLLCLTFNGLSKSYRVAGFRSGWLIISGPKHHAHSYIEGIDMLA
NMRLCANVPAQHAIQTALGGYQSINDLVLPPGRLLEQRNRTYELLNDIPGVSCVKPMGAL
YAFPRIDPKVCPILNDEKFALDLLLSEKLLIVQGTAFNWPWPDHFRVVTLPRVDDLEAAI
GRIGNFLKGYSQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgccaggcgttcagtctggcacccgcttcctgccctttcaaacctttcggcggggcgta
gcgcgttttctcaatcgggatcccatcatgcagttcagcaaatcgaacaagctcgccaat
gtctgctacgacattcgcggcccagtgctcaagcacgccaaacgcctggaggaggaaggc
caccgcatcctcaagctgaacatcggcaacccggcgccgtttggcttcgaggcgcctgat
gaaatccttcaggatgtgatccgcaacctgcccaccgcacagggctacagcgactccaaa
ggcctgttcagtgcccgcaaggcggtgatgcagtactgccagcagaaagaaatcgaaggc
gtcaccatcgaggacatctacctgggtaatggtgtgtccgagctgatcgtcatgtcgatg
caggcgctgctcaacaacggcgacgaagtgctgatcccggcccccgactacccgctgtgg
acagccgccgtgagcctggccggcggcaagccggtgcactacctgtgcgacgagcaggcc
gactggttccctgaccttgaggacatcaaggccaagatcaccccaaacaccaaggcgctg
gtgatcatcaacccgaacaacccgaccggcgccgtctactccaaagagctgctgctgggc
atgctggagctggcgcgccagcacaacctggtggtgttctccgacgagatctacgacaag
atcctgtacgacgaagctgtgcacatcagcaccgcctcgctggccccggacctgctgtgc
ctgaccttcaacggcttgtccaagtcataccgggtggcgggcttccgctctggctggctg
atcatttccgggcccaagcaccacgcacacagctacatcgaaggcatcgacatgctggcc
aacatgcgcctgtgcgccaacgtgccggcccagcatgccatccagaccgcgctgggcggc
taccagagcatcaacgacctggtgctgccaccggggcgcctgctggagcagcgcaaccgc
acctacgaactgctcaacgacatccccggcgtcagctgcgtgaagccgatgggcgcgctg
tatgcattcccgcggatcgacccgaaggtttgcccgatcctcaacgacgagaagttcgcc
cttgacctgttgctgtcggagaagctgctgatcgtacaaggaacggcgttcaactggccg
tggccggaccacttccgcgtggtgaccttgccgcgggtggacgacctggaagcagccatt
ggccggatcggcaatttcctgaagggttattcgcagtag

DBGET integrated database retrieval system