KEGG   Pseudomonas putida ND6: YSA_02104Help
Entry
YSA_02104         CDS       T02170                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ppi  Pseudomonas putida ND6
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YSA_02104
Enzymes [BR:ppi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     YSA_02104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1125730..1126275
Genome map
AA seq 181 aa AA seqDB search
MSLEQNYTEILSQIGEDVSREGLLDTPKRAAKAMKYLCRGYEQTLEEVTNNALFSSDNSE
MVLVRDIELYSMCEHHMLPFIGKAHVAYLPKGKVLGLSKVARIVDMYARRLQIQENLSRQ
IAEAVQQVTGAAGVAVVVEAKHMCMMMRGVEKQNSTMITSVMLGEFRDNAATRSEFLSLI
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaacagaactacaccgagatcctcagccagattggcgaggacgtctcccgt
gagggcctgctcgacacgcccaagcgggctgcaaaggcgatgaagtacctttgccgcggt
tatgagcaaacactggaagaagtcaccaacaacgctttgttcagctctgacaacagcgaa
atggtgctggtccgggacatcgagctgtattcgatgtgcgaacaccacatgctgccgttc
attggcaaggcacacgttgcctacctgccgaagggcaaggtactgggcctgtccaaggtg
gcacgtatcgtcgacatgtacgcccgccgcctgcagatccaggaaaacctcagccgccag
atcgccgaagccgtgcagcaggtaaccggtgccgcgggtgtggccgtggtggtcgaagcc
aagcacatgtgcatgatgatgcgcggtgtcgaaaagcagaattcgaccatgatcacctcg
gtgatgctgggtgagttccgcgataacgccgccacccgtagcgagttcctcagcctgatc
aagtga

DBGET integrated database retrieval system