KEGG   Pseudomonas putida ND6: YSA_02529Help
Entry
YSA_02529         CDS       T02170                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ppi  Pseudomonas putida ND6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1364609..1365283)
Genome map
AA seq 224 aa AA seqDB search
MREDDMLRRGIGMTSQRTRERLIQRLCEEGVSNTKVLDVIRRTPRHLFVDEALAHRAYED
TALPIGHNQTISQPFMVAHMSELLLEAGPLDKVLEIGTGSGYQTAILAQLVERVFSVERI
KVLQDRAKERLVELNLRNVVFRWGDGCEGWPALAPYNGIIVTAVAPEVPQALLDQLAPGG
RMVIPVGPAGEAQQLMLIVREEHGFSRRVLGAVRFVPLLNGPLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggacgatatgctgcggcgtggcatcggcatgacctctcagcgtacccgggag
cggctgatacagcgcttgtgcgaagagggggtttcgaacaccaaggtgctcgacgtgatc
cggcgtacgccgcgccacctgttcgtcgacgaggcgctggcgcatcgagcatacgaagac
accgcgctgccgatcggccacaaccagaccatctcccagccgttcatggttgctcacatg
agcgagctgttgctcgaggccgggccgctggacaaggtgctggagattggcaccggttcg
ggctaccagacggcgatcctggctcagctggtcgagcgggtgttttcggtagagcgcatc
aaggtgctgcaggaccgggccaaagagcgcctggtggagcttaacctgcgcaacgtggta
ttccgctggggtgacggttgtgaggggtggccggcgcttgcgccgtacaacggcatcatc
gtcaccgccgtggcgccggaagtgccacaggcactgctcgaccaactggcacccggtgga
cgcatggtcatcccggtagggccggccggcgaagcgcagcaactgatgctgatcgtgcgc
gaggagcatggattctcccgtcgcgtactgggggctgtgcgcttcgtgcctctgctcaat
gggcctctggcctga

DBGET integrated database retrieval system