KEGG   Pseudomonas putida ND6: YSA_02662Help
Entry
YSA_02662         CDS       T02170                                 

Definition
chemotaxis-specific methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
ppi  Pseudomonas putida ND6
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YSA_02662
Enzymes [BR:ppi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     YSA_02662
Two-component system [BR:ppi02022]
 CheA family
  WspE-WspRF
   YSA_02662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1442492..1443505)
Genome map
AA seq 337 aa AA seqDB search
MKIAIVNDMPLAVEALRRAVALEPAHQVVWVASNGAEAVQRCTEQLPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDRKQNVHRVFEAMGHGALDVVDTPALGAGDAREAAAPLL
RKILNIGWLVGQQRAPAARSVAAPLREASQRRGLVAIGSSAGGPAALEVLLKGLPAAFPA
AIVLVQHVDQVFAAGMAEWLSSAAGLPVRLAREGEPPQPGQVLLAGTNHHIRLLQSGQLA
YTAEPVNEIYRPSIDVFFESVARYWNGDAVGVLLTGMGRDGAQGLKLMRQQGFLTIAQDQ
ASSAVYGMPKAAAAIDAAVEIRPLERIAGRLTEFFAK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccatcgtcaatgacatgcccctggccgtcgaagcgttgcgccgggcggtt
gccctggagcccgcacaccaggtcgtgtgggtggccagcaacggtgccgaggcggtgcag
cgctgcaccgagcagttaccggacctgatcctcatggacctgatcatgccggtgatggac
ggtgtcgaggcgacccggcggatcatggccgaaaccccgtgcgccattgtcatcgtcacg
gtcgaccgcaagcagaacgtacaccgggtattcgaggccatgggccatggcgcgctcgat
gtggtcgacacgcctgcgctgggcgctggcgatgcccgcgaagcagcggcgccattgctg
cgcaagatcctcaatatcggctggctggtcggccagcagcgtgcacctgccgcaaggtcg
gtggctgcaccgctgcgcgaggcttcccagcgccgcgggttggtggcaatcgggtcttcg
gcgggtggcccggcagcactcgaagtattgctcaagggcttgccggcagcgtttccggcg
gccatcgtcctggtccagcatgtggaccaggtgtttgccgcaggcatggccgaatggctc
agcagcgcagcaggcctgccggtgcgcctggcccgtgaaggcgaaccgccgcagccaggg
caggtactcctggccggtaccaaccaccacattcgcctgctacagagcggccaactggcc
tacactgccgaacctgtgaatgaaatctaccggccctcgatcgatgtgttctttgagagc
gtggcacgttactggaatggtgatgcggtgggcgtgctgctcaccggcatgggccgcgac
ggtgcccagggcctgaagctgatgcgtcagcagggctttctgaccattgctcaggaccag
gccagcagcgcggtgtacggcatgcccaaggctgctgcggctattgatgccgcggtggag
attcgcccgctggaacgcatagccgggcgcttgactgaatttttcgcaaaatga

DBGET integrated database retrieval system