KEGG   Pseudomonas putida ND6: YSA_02710Help
Entry
YSA_02710         CDS       T02170                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppi  Pseudomonas putida ND6
Brite
Enzymes [BR:ppi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YSA_02710
Secretion system [BR:ppi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   YSA_02710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1467213..1467956)
Genome map
AA seq 247 aa AA seqDB search
MRVTQFFAAAALALASTFAVAAATDSNAGAEQAIRKSLQNLELEVPVESVASSPLNGLYE
VKLQGGRVLYASADGQFVMQGYLFQIQDGKPVNLTEKTERQGIAKLINGIPAAEMVVYPA
KGETKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLGSAGDQQLQAVWCS
SDRRGAMDKMVEGEEIKAAKCTNPVSKQFQLGQSIGVNGTPAIVLESGQVIPGYQPAPQV
AKLALAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagtttttcgccgccgccgcgttggcgctggccagtacctttgccgtt
gccgcggcaaccgatagcaacgccggtgccgagcaggccatccgtaaatcgttgcagaac
ctcgagttggaagtgcccgtggaaagcgtggccagcagcccgctcaacggcctgtatgaa
gtcaagctgcagggcggccgcgtgctgtacgccagcgctgacggccaattcgtgatgcag
ggctacctgttccagatccaggacggcaagccggtcaacctcaccgaaaaaaccgaacgc
caaggtatcgccaagctcatcaacggcattccagccgccgagatggtggtttatcctgcc
aaaggcgagaccaagtcgcacatcaccgtgttcaccgacactacctgcccgtactgccac
aaactgcacgccgaagtgcctgagttaaaccgtcgcggtatcgaagtgcgctatgtcgcc
ttcccgcgtcagggcctcggttcggcgggtgaccagcagttgcaggcggtgtggtgctcc
agcgaccgccgtggggcgatggacaaaatggtcgaaggtgaagaaatcaaggccgccaag
tgcaccaacccggtcagcaagcagttccagctgggtcagtcgatcggtgtcaacggcacg
ccggccattgttcttgaaagcggccaagtcattccgggctaccagccggcaccgcaggtc
gccaagctggcacttgccaagtaa

DBGET integrated database retrieval system