KEGG   Pseudomonas putida ND6: YSA_03200Help
Entry
YSA_03200         CDS       T02170                                 

Definition
(GenBank) short chain dehydrogenase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00670  One carbon pool by folate
ppi00790  Folate biosynthesis
ppi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YSA_03200
   00670 One carbon pool by folate
    YSA_03200
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     YSA_03200
    1.5.1.50  dihydromonapterin reductase
     YSA_03200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase RmlD_sub_bind NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AFK68505
UniProt: I3USN4
Position
1729504..1730241
Genome map
AA seq 245 aa AA seqDB search
MLGGNQRTDKLTTPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSILPQAAHPNI
VQFQADLCQADDRQALIDHLHDRYDGLRAIIHNASLWLDDGLDNLETMFRLHVEAPYHLN
LALGDLLAKVEKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGI
LPGLLILKEGGDEAYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHL
KNRMT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtggcaaccaaaggacagacaagttgaccaccccgaacatgaacagccccatt
ctcgttaccggagccagccagcgtgtcgggctggccctggccctcgaactggcacaggcc
ggccatacggtggtcagtgccagccgcagcatcctgccccaggcagcccaccccaacatc
gtgcagtttcaggccgacctgtgccaggcggacgaccgccaggcgctgatcgatcacctg
cacgatcgttacgacggactgcgcgccatcatccacaacgcctcgctatggctcgacgac
ggcctcgacaacctcgagaccatgttccgcctgcacgtcgaagcgccctaccacctcaac
ctggccctgggcgacctgctggccaaggtggaaaaggccgacatcattcacatctgcgac
gaaacctcttcgcgcggcagtaaaagccacatcggctacgccgccaccaaggccgcactg
cagaacatggtgctgtcatttgctgaaaaatatgcgcccaaggtgcgtgtgaacggtatc
ctgcccgggctgctgatcctcaaggaagggggtgacgaagcctaccgccagcaaaccctg
aaaaaggccctgctggaattcgaacccggcgccggcccgctgatcgagaccgtcaagtac
ctgctcgccagccagtacagcaccggcagccaggtggtcatcaacggtggccgccacctg
aagaaccgcatgacttga

DBGET integrated database retrieval system