KEGG   Pseudomonas putida ND6: YSA_03281Help
Entry
YSA_03281         CDS       T02170                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppi  Pseudomonas putida ND6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YSA_03281
Enzymes [BR:ppi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     YSA_03281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1773615..1775690)
Genome map
AA seq 691 aa AA seqDB search
MSRSLVDLLPTPLHAEHLLALAPQHNSADLLQLLDRWVERGWLRALDRAFVSFLEERAPG
SDPLLLLAAALASHQLGHGHVCLDLQQTLAEPDFALSLPPEGDALIGPLLLPSQLLANLD
LNAWLQRIVASPLVAAGDTPGQQARPLVRSGERLYLRRYWRYERRIDHALRQRLSQAEAP
PADLPERLAQLFEGGAPAGQVDWQKLACALATRAGFSIITGGPGTGKTTTVVRLLALLQA
PAVEQGRPLRIRLAAPTGKAAARLTESIGQQVERLQVSAEVRGQIPTEVSTVHRLLGSRP
GSRHFRHHAGNPLPLDVLVVDEASMIDLEMMANLLDALPPRARLVLLGDKDQLASVEAGA
VLGDLCRDAEEGFYSPATAAWLQQVSGESLAGSGLKAGDEQRHPLAQQVVMLRFSRRFGE
GSGIGQLARLVNRQDAHAARNLLAAPPADVHSLSLKHEQDRAFDRLLLDGLNRGTDGPQG
YRSYLRTLGRYRPALDTAFDDPAWEQWAGKVLRSFEDFQLLCAVRRGAWGVEGLNERVAR
VLHNAGLIDSQQPWYEGRPVLVTRNDYGLGLMNGDIGIALRLPDEQGQPLLRVAFPRNDG
SGGVRFVLPSRLNEVETVFAMTVHKSQGSEFSHTALVLPDALNPVLTKELVYTGITRAKH
CFSLVEPRQGIFEEAVARKVRRISGLMLEQV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaagccttgtcgacctgttgcccaccccgttgcacgccgagcacctgctggcg
ctggcaccgcagcacaacagcgctgatttgctgcaattactcgaccgttgggttgagcgg
ggctggctacgtgccctggaccgcgcattcgtgtcgttcctggaagagcgtgcccccggc
agtgatcccttgctattgctggcagcggcgctggccagccaccaactggggcacgggcat
gtctgcctcgacctgcaacaaaccttggccgagcctgatttcgccctgtcgttgccgccg
gaaggtgacgcccttatcggccctttgctactgccatcgcaactgctggccaaccttgac
ttgaatgcctggcttcagcgcatcgtcgccagcccgctggtggccgcaggtgatacgcct
ggccagcaggcgcggccactggtacgcagtggcgagcgcctttacctgcgccgttactgg
cgttacgagcggcgcattgaccatgccctgcgccagcgcctgagtcaggccgaagcaccg
cctgcggacctgccagagcgcctggcgcaactgttcgagggcggcgcgccagctggccag
gtggactggcagaagcttgcctgcgccttggccacccgggccggtttcagcatcatcacg
ggtggccccggcaccggcaagacgaccaccgtggtgcgcctgctggcgttgctgcaggcg
ccggcagtggagcagggtaggccactgcgcatccgcctggctgcaccgaccggcaaggcc
gctgcgcgcctgaccgaatccattggccagcaagtcgagcgcctgcaagtcagcgccgaa
gtacgcgggcaaatccccactgaagtcagcaccgtgcatcgtctgctcggaagccgcccg
ggctcgcggcacttccgccaccacgctggcaacccgttgccgttggatgtgctggtggtc
gatgaggcgtcgatgatcgacctggaaatgatggccaacctgctcgatgccttgccgccg
cgggcgcgtctggtgctgctgggcgacaaggaccagttggcctcggtcgaggccggcgcg
gtgctgggtgacctatgccgggatgctgaggagggcttttactcgccggcgactgctgcg
tggcttcagcaggtcagtggcgagtcgctggccggcagtggcctcaaggccggcgatgag
cagcgccacccgttggctcagcaagtggtgatgctgcggttttcacggcgtttcggtgaa
ggcagcggtattggccagttggccagactggtcaatcgtcaggatgctcacgcggcgcgc
aacctgctggccgcgccgcctgctgacgtgcacagcctgtcgctcaagcacgagcaggat
cgtgctttcgaccgcctgttactggacggtctgaaccgcggtaccgatggaccgcaaggc
taccgcagctacctgcgcacccttgggcgttaccggccagcacttgataccgcctttgac
gaccccgcctgggagcaatgggcgggcaaggtgttgcgcagtttcgaggatttccagttg
ctgtgcgcggtgcgccggggcgcctggggggtcgaaggcctgaatgaacgggtggcgcgg
gtgctgcacaatgccggtctgatcgacagccagcagccttggtacgaaggacgcccggtg
ctggtgacccgcaacgactacggcctgggcctgatgaacggtgacatcggtatagccctg
cgcctgccggatgagcagggccagccgctgctgcgtgtggccttcccgcgcaacgacggc
agtggtggtgtgcggttcgttctgccgagccggctcaacgaagtggaaacggtattcgcc
atgaccgtgcacaagtcccagggctcggagttcagccacactgccctggtgctgccggat
gcgctcaacccggtgctgaccaaggaactggtgtacaccggcatcacgcgggccaagcac
tgcttcagcctggtcgagccacgccaaggcattttcgaagaagcggtggcgcgcaaagta
cggcgtatttccgggttgatgctcgagcaggtctag

DBGET integrated database retrieval system