KEGG   Pseudomonas putida ND6: YSA_03395Help
Entry
YSA_03395         CDS       T02170                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00010  Glycolysis / Gluconeogenesis
ppi00051  Fructose and mannose metabolism
ppi00562  Inositol phosphate metabolism
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01200  Carbon metabolism
ppi01230  Biosynthesis of amino acids
Module
ppi_M00002  Glycolysis, core module involving three-carbon compounds
ppi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YSA_03395
   00051 Fructose and mannose metabolism
    YSA_03395
   00562 Inositol phosphate metabolism
    YSA_03395
Enzymes [BR:ppi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YSA_03395
Exosome [BR:ppi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YSA_03395
  Exosomal proteins of bladder cancer cells
   YSA_03395
  Exosomal proteins of melanoma cells
   YSA_03395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFK68608
UniProt: I3USY7
Position
complement(1837315..1838058)
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELTKGLSNLALPSGVEVAVFPPALFINQVIDGLAGKEITVGAQN
SAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKGLKPV
LCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFADAVIAYEPVWAIGTGLTATPQQAQ
DVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaaaatgcacggtacccgcgctagcgtcgctgagctgaccaaa
ggcttgagtaatctcgccttgccgagcggagtggaagtcgccgtatttccaccagccttg
ttcatcaatcaggtgattgatggcctggcaggtaaagaaattactgtcggtgcacagaat
tctgctgtacaacccgaacagggtgcgctgaccggggaagttgctccggagcagctggtt
gaagcaggttgcaagttggtgttgattggccattcggagcgtcgccagattattggtgaa
accgacgaagtgctcaatcgcaagtttgcagcagcccaggccaaaggcttgaagccagtg
ctttgcataggggaaacccttgaggagcgcgaggctggcaaaacgctcgaagttgtcggg
cgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgccgatgcagtaatt
gcctatgagcctgtatgggccatcggtacaggccttacggccacgccacagcaggcccag
gatgtgcacgccgccatccgtggccagttggcggcagaagatgctgaagtggctgcgaag
gtgcagttgctatacggcggcagcgtgaaggcggccaatgcggccgaactgttcggcatg
ccggatatcgatggggggctcattggtggggcttccctgaacgcagacgaattcggtgca
atttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system