KEGG   Pseudomonas putida ND6: YSA_03395Help
Entry
YSA_03395         CDS       T02170                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ppi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ppi00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1837315..1838058)
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELTKGLSNLALPSGVEVAVFPPALFINQVIDGLAGKEITVGAQN
SAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKGLKPV
LCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFADAVIAYEPVWAIGTGLTATPQQAQ
DVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaaaatgcacggtacccgcgctagcgtcgctgagctgaccaaa
ggcttgagtaatctcgccttgccgagcggagtggaagtcgccgtatttccaccagccttg
ttcatcaatcaggtgattgatggcctggcaggtaaagaaattactgtcggtgcacagaat
tctgctgtacaacccgaacagggtgcgctgaccggggaagttgctccggagcagctggtt
gaagcaggttgcaagttggtgttgattggccattcggagcgtcgccagattattggtgaa
accgacgaagtgctcaatcgcaagtttgcagcagcccaggccaaaggcttgaagccagtg
ctttgcataggggaaacccttgaggagcgcgaggctggcaaaacgctcgaagttgtcggg
cgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgccgatgcagtaatt
gcctatgagcctgtatgggccatcggtacaggccttacggccacgccacagcaggcccag
gatgtgcacgccgccatccgtggccagttggcggcagaagatgctgaagtggctgcgaag
gtgcagttgctatacggcggcagcgtgaaggcggccaatgcggccgaactgttcggcatg
ccggatatcgatggggggctcattggtggggcttccctgaacgcagacgaattcggtgca
atttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system