KEGG   Pseudomonas putida ND6: YSA_03395Help
Entry
YSA_03395         CDS       T02170                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YSA_03395
   01230 Biosynthesis of amino acids
    YSA_03395
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YSA_03395
   00051 Fructose and mannose metabolism
    YSA_03395
   00562 Inositol phosphate metabolism
    YSA_03395
Enzymes [BR:ppi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YSA_03395
Exosome [BR:ppi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YSA_03395
  Exosomal proteins of bladder cancer cells
   YSA_03395
  Exosomal proteins of melanoma cells
   YSA_03395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1837315..1838058)
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELTKGLSNLALPSGVEVAVFPPALFINQVIDGLAGKEITVGAQN
SAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKGLKPV
LCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFADAVIAYEPVWAIGTGLTATPQQAQ
DVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaaaatgcacggtacccgcgctagcgtcgctgagctgaccaaa
ggcttgagtaatctcgccttgccgagcggagtggaagtcgccgtatttccaccagccttg
ttcatcaatcaggtgattgatggcctggcaggtaaagaaattactgtcggtgcacagaat
tctgctgtacaacccgaacagggtgcgctgaccggggaagttgctccggagcagctggtt
gaagcaggttgcaagttggtgttgattggccattcggagcgtcgccagattattggtgaa
accgacgaagtgctcaatcgcaagtttgcagcagcccaggccaaaggcttgaagccagtg
ctttgcataggggaaacccttgaggagcgcgaggctggcaaaacgctcgaagttgtcggg
cgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgccgatgcagtaatt
gcctatgagcctgtatgggccatcggtacaggccttacggccacgccacagcaggcccag
gatgtgcacgccgccatccgtggccagttggcggcagaagatgctgaagtggctgcgaag
gtgcagttgctatacggcggcagcgtgaaggcggccaatgcggccgaactgttcggcatg
ccggatatcgatggggggctcattggtggggcttccctgaacgcagacgaattcggtgca
atttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system