KEGG   Pseudomonas putida ND6: YSA_03401Help
Entry
YSA_03401         CDS       T02170                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ppi  Pseudomonas putida ND6
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1839493..1840272)
Genome map
AA seq 259 aa AA seqDB search
MGILNITPDSFSDGGRFSQRDEALRHAEAMVAAGATLIDIGGESTRPGARAVSVTEELER
VAPMVEAINSRLDVVISVDTSTPAVMREAARLGAGLINDVRALERDGALDAAADTGLPVC
LMHMRGEPGNMQDDPHYEDVTADVTRYLEQRMAACAAAGIDADRIILDPGFGFAKTLAHN
LSLFKHMDALYRLGRPLLVGVSRKSMIGLTLERPVGERLYGSLALAALAMTKGASILRVH
DVAETVDVVRMIAAVQNAE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggtattctcaatatcacccccgattccttctccgatggcggtcgcttcagtcagcgc
gacgaggccctgcgccatgccgaagcgatggtggccgctggcgcaacgctgatcgacatc
ggtggcgagtccacgcgcccaggtgcgcgtgcagtgtcggtgaccgaggagctggagcgt
gtggcgccaatggtcgaggccatcaacagtcgtctcgacgtggtcatttcggtcgatacc
tccacgcctgctgtcatgcgtgaagcagcccgcctgggtgccgggctgatcaacgacgtg
cgggccctggagcgcgatggtgccctggacgctgcggcggacaccggtctgccggtgtgc
ctcatgcacatgcgtggcgagccgggtaacatgcaggacgatccgcattacgaggacgtg
accgccgacgtcacccgttatctagaacagcggatggccgcctgcgccgcagcgggcatc
gatgctgacagaatcatccttgacccgggcttcggtttcgccaagacactggcgcacaat
ctgagcctgttcaagcacatggacgcgctctatcgccttgggcgcccactgctggtgggt
gtttcacgaaagagcatgatcggcctgacgctggaacgtccggtcggcgagcgcttgtac
ggcagccttgcgctggcggcgttggccatgaccaagggagcgagcatccttcgggtacat
gacgtggccgaaaccgttgatgtggtgcgcatgatcgctgcggtgcaaaacgccgaataa

DBGET integrated database retrieval system