KEGG   Pseudomonas putida ND6: YSA_03401Help
Entry
YSA_03401         CDS       T02170                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ppi  Pseudomonas putida ND6
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YSA_03401
Enzymes [BR:ppi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     YSA_03401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1839493..1840272)
Genome map
AA seq 259 aa AA seqDB search
MGILNITPDSFSDGGRFSQRDEALRHAEAMVAAGATLIDIGGESTRPGARAVSVTEELER
VAPMVEAINSRLDVVISVDTSTPAVMREAARLGAGLINDVRALERDGALDAAADTGLPVC
LMHMRGEPGNMQDDPHYEDVTADVTRYLEQRMAACAAAGIDADRIILDPGFGFAKTLAHN
LSLFKHMDALYRLGRPLLVGVSRKSMIGLTLERPVGERLYGSLALAALAMTKGASILRVH
DVAETVDVVRMIAAVQNAE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggtattctcaatatcacccccgattccttctccgatggcggtcgcttcagtcagcgc
gacgaggccctgcgccatgccgaagcgatggtggccgctggcgcaacgctgatcgacatc
ggtggcgagtccacgcgcccaggtgcgcgtgcagtgtcggtgaccgaggagctggagcgt
gtggcgccaatggtcgaggccatcaacagtcgtctcgacgtggtcatttcggtcgatacc
tccacgcctgctgtcatgcgtgaagcagcccgcctgggtgccgggctgatcaacgacgtg
cgggccctggagcgcgatggtgccctggacgctgcggcggacaccggtctgccggtgtgc
ctcatgcacatgcgtggcgagccgggtaacatgcaggacgatccgcattacgaggacgtg
accgccgacgtcacccgttatctagaacagcggatggccgcctgcgccgcagcgggcatc
gatgctgacagaatcatccttgacccgggcttcggtttcgccaagacactggcgcacaat
ctgagcctgttcaagcacatggacgcgctctatcgccttgggcgcccactgctggtgggt
gtttcacgaaagagcatgatcggcctgacgctggaacgtccggtcggcgagcgcttgtac
ggcagccttgcgctggcggcgttggccatgaccaagggagcgagcatccttcgggtacat
gacgtggccgaaaccgttgatgtggtgcgcatgatcgctgcggtgcaaaacgccgaataa

DBGET integrated database retrieval system