KEGG   Pseudomonas putida ND6: YSA_04095Help
Entry
YSA_04095         CDS       T02170                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ppi  Pseudomonas putida ND6
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YSA_04095
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YSA_04095
Enzymes [BR:ppi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     YSA_04095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2208089..2209093
Genome map
AA seq 334 aa AA seqDB search
MTPIDAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLFDTLRNLEAMAADMFVV
RHSDSGAAHFIAEHVCPEVAVINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI
LHSRVARSDMLALKALGCPDIRVIGPKTLIPIGIEQYGVKVYTDLAEGLKDVDVVIMLRL
QRERMAGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGKHSVI
LNQVTYGIAVRMAVLSMAMSGQNAQRQLDQENAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaatcgacgccaagcgcccgctgcagctcaatgatcagggccagctgcgccac
ttcctctcgcttgacggtttgcctcgcgaactgctcaccgagatcctcgacaccgccgac
tccttcctggaagtcggtgcccgggctgtgaaaaaagtcccgttgctgcgcggcaagact
gtgtgcaacgtgttcttcgagaactcgacccgtacccgtaccaccttcgaactggcagcc
cagcgcctgtcggccgacgtgatcagcctgaacgtgtcgacctcctcgaccagcaagggc
gaaaccctgttcgacaccctgcgcaacctcgaagccatggccgccgacatgttcgtcgta
cgccactccgactccggcgccgcgcacttcatcgccgagcacgtgtgcccggaagtggcc
gtgatcaacggcggtgacggccgccacgcgcacccgacccagggcatgctcgacatgctc
accatccgccgtcacaaaggcagcttcgaaaacctgtccgtggcgatcgtcggcgacatc
ctgcactcgcgtgtggcccgttccgacatgctcgcgctcaaagcgctgggttgcccggac
atccgtgtgatcgggccgaaaaccctgatcccgatcggtatcgagcagtacggcgtgaag
gtctacaccgacctcgccgaaggcctgaaagacgtcgacgtggtgatcatgctgcgcctg
cagcgtgagcgcatggccggtggcctgctgcccagtgaaggcgagttctaccgcctgttc
ggcctgacgaccgcgcgcctggccggggccaagcctgacgccatcgtcatgcacccgggc
ccgatcaaccgtggcgtagaaatcgagtcggcggttgccgatggcaagcactcggtgatc
ctcaaccaggtcacctacggtatcgccgtgcgcatggccgtgctgtccatggccatgagc
gggcagaacgcgcaacgtcaattggaccaggagaatgcccagtga

DBGET integrated database retrieval system