KEGG   Pseudomonas putida ND6: YSA_04816Help
Entry
YSA_04816         CDS       T02170                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppi  Pseudomonas putida ND6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YSA_04816
   00030 Pentose phosphate pathway
    YSA_04816
   00051 Fructose and mannose metabolism
    YSA_04816
   00052 Galactose metabolism
    YSA_04816
   00500 Starch and sucrose metabolism
    YSA_04816
   00520 Amino sugar and nucleotide sugar metabolism
    YSA_04816
  Nucleotide metabolism
   00230 Purine metabolism
    YSA_04816
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YSA_04816
Enzymes [BR:ppi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     YSA_04816
    5.4.2.8  phosphomannomutase
     YSA_04816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2608466..2609881
Genome map
AA seq 471 aa AA seqDB search
MELPEMNDMAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVS
VGRDGRLSGPMLVEQLIKGLVDAGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPS
DYNGFKIVIAGDTLANEQIQALLTRLKTNDLTLAQGRVEKVEILDCYFQQIVGDVKLAKK
LKVVVDCGNGAAGVIAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKE
TGADIGLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTP
LIEQHGGSALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEI
LSKTQQSAEDLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEAHLTTIDGVRVD
YANGWGLVRASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccagagatgaacgacatggcccacctggtccccgccgcattgcccgacagc
attttccgcgcatatgacatacgcggcgtggtcggcaagacccttcacgccgaaactgcc
tactggatcggccgcgccatcggcgcgcaaagcctggcccagggcgaaccgcaggtttcg
gtagggcgcgatggccgcctgtcgggcccgatgctggtggaacagctgatcaagggcctg
gtcgatgcgggctgccacgtcagcgacgtcggcctggtgcctaccccggcgctgtactac
gcagccaacgtgctggccggcaagtccggtgtgatgctgaccggcagccacaacccttcg
gactacaacggtttcaagatcgtcatcgccggtgacaccttggccaacgaacagatccag
gccctgctgacccgcctgaaaaccaacgacctgaccctggcccaaggccgcgtggagaag
gtcgagatcctcgactgctacttccagcagatcgtcggcgacgtaaagctggcgaaaaag
ctcaaggtggtggtggactgcggcaacggcgccgctggcgtgattgcaccgcaactgatc
gaagccctgggctgcgaagtgatcccgctgttctgcgaggtcgacggcaacttccccaac
caccacccggacccgggcaagccggagaacctcgaagacctgatcgccaaggtcaaggaa
accggtgccgatatcggcctggccttcgacggtgacggcgaccgcgtcggcgtggtgacc
aacaccggcagcatcgtctaccccgaccgcctgctgatgctgtttgcccaggacgtgctg
tcgcgcaacccgggcgccgagatcatcttcgatgtcaaatgcacccgccgcctgaccccg
ctgatcgaacagcacggtggcagcgccttgatgtggaaaaccggccattcgctgatcaaa
aagaagatgaagcagaccggttcgctgctggcaggcgagatgagcggtcacatcttcatc
aaggaacgttggtacggttttgacgacggtatctacagcgccgcgcgcctgttggagatc
ctcagcaagacccagcagagcgccgaagacctgtttgccgccttcccgaatgatatttcc
acgccggaaatcaatattgatgtgaccgacgagggtaaattcagcatcattgatgcactg
caacgcgacgccgactggggcgaagcccacctgaccaccattgacggtgtgcgggtcgac
tacgccaatggctggggcctggttcgcgcctccaacaccaccccggtgctggtgctgcgc
ttcgaggccgacagcgacgccgagttgcaacgtatcaaggatgttttccgcacccagttg
ctgcgggtagagcctgagctgcaactgccgttctga

DBGET integrated database retrieval system