KEGG   Pseudomonas putida ND6: YSA_04816Help
Entry
YSA_04816         CDS       T02170                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00010  Glycolysis / Gluconeogenesis
ppi00030  Pentose phosphate pathway
ppi00051  Fructose and mannose metabolism
ppi00052  Galactose metabolism
ppi00230  Purine metabolism
ppi00500  Starch and sucrose metabolism
ppi00520  Amino sugar and nucleotide sugar metabolism
ppi00521  Streptomycin biosynthesis
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YSA_04816
   00030 Pentose phosphate pathway
    YSA_04816
   00051 Fructose and mannose metabolism
    YSA_04816
   00052 Galactose metabolism
    YSA_04816
   00500 Starch and sucrose metabolism
    YSA_04816
   00520 Amino sugar and nucleotide sugar metabolism
    YSA_04816
  Nucleotide metabolism
   00230 Purine metabolism
    YSA_04816
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YSA_04816
Enzymes [BR:ppi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     YSA_04816
    5.4.2.8  phosphomannomutase
     YSA_04816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFK69376
UniProt: I3UV55
Position
2608466..2609881
Genome map
AA seq 471 aa AA seqDB search
MELPEMNDMAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVS
VGRDGRLSGPMLVEQLIKGLVDAGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPS
DYNGFKIVIAGDTLANEQIQALLTRLKTNDLTLAQGRVEKVEILDCYFQQIVGDVKLAKK
LKVVVDCGNGAAGVIAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKE
TGADIGLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTP
LIEQHGGSALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEI
LSKTQQSAEDLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEAHLTTIDGVRVD
YANGWGLVRASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccagagatgaacgacatggcccacctggtccccgccgcattgcccgacagc
attttccgcgcatatgacatacgcggcgtggtcggcaagacccttcacgccgaaactgcc
tactggatcggccgcgccatcggcgcgcaaagcctggcccagggcgaaccgcaggtttcg
gtagggcgcgatggccgcctgtcgggcccgatgctggtggaacagctgatcaagggcctg
gtcgatgcgggctgccacgtcagcgacgtcggcctggtgcctaccccggcgctgtactac
gcagccaacgtgctggccggcaagtccggtgtgatgctgaccggcagccacaacccttcg
gactacaacggtttcaagatcgtcatcgccggtgacaccttggccaacgaacagatccag
gccctgctgacccgcctgaaaaccaacgacctgaccctggcccaaggccgcgtggagaag
gtcgagatcctcgactgctacttccagcagatcgtcggcgacgtaaagctggcgaaaaag
ctcaaggtggtggtggactgcggcaacggcgccgctggcgtgattgcaccgcaactgatc
gaagccctgggctgcgaagtgatcccgctgttctgcgaggtcgacggcaacttccccaac
caccacccggacccgggcaagccggagaacctcgaagacctgatcgccaaggtcaaggaa
accggtgccgatatcggcctggccttcgacggtgacggcgaccgcgtcggcgtggtgacc
aacaccggcagcatcgtctaccccgaccgcctgctgatgctgtttgcccaggacgtgctg
tcgcgcaacccgggcgccgagatcatcttcgatgtcaaatgcacccgccgcctgaccccg
ctgatcgaacagcacggtggcagcgccttgatgtggaaaaccggccattcgctgatcaaa
aagaagatgaagcagaccggttcgctgctggcaggcgagatgagcggtcacatcttcatc
aaggaacgttggtacggttttgacgacggtatctacagcgccgcgcgcctgttggagatc
ctcagcaagacccagcagagcgccgaagacctgtttgccgccttcccgaatgatatttcc
acgccggaaatcaatattgatgtgaccgacgagggtaaattcagcatcattgatgcactg
caacgcgacgccgactggggcgaagcccacctgaccaccattgacggtgtgcgggtcgac
tacgccaatggctggggcctggttcgcgcctccaacaccaccccggtgctggtgctgcgc
ttcgaggccgacagcgacgccgagttgcaacgtatcaaggatgttttccgcacccagttg
ctgcgggtagagcctgagctgcaactgccgttctga

DBGET integrated database retrieval system