KEGG   Pseudomonas putida ND6: YSA_04831Help
Entry
YSA_04831         CDS       T02170                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ppi  Pseudomonas putida ND6
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ppi00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2614731..2615351
Genome map
AA seq 206 aa AA seqDB search
MNHSSGTLYIVSAPSGAGKTSLVTALTKDDQQIRVSVSHTTRAMRPGEQHGVNYHFVVHE
EFKTLIAQGDFLEHAEVFGNFYGTSRSALQHTLDQGYDLILEIDWQGAQQVRKLMPEALS
VFILPPSQEALRHRLDGRGQDSEEIIAGRMKEAVSEMVHYDEYDYVIINDDFDAALADLK
AVFRSNRLLLKKQQQRHAALLKQMIG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacagcagcggcaccctctacatcgtttcggccccctcgggtgccggcaagacc
agcctggtcaccgccctgaccaaagacgaccagcagattcgcgtctcggtctcgcacact
acccgcgccatgcgcccgggcgagcagcacggggtgaactatcacttcgtcgtccacgag
gagttcaagacgctgatcgcgcaaggagactttctggagcatgccgaagtgttcggcaac
ttctacggtacttcgcgcagcgcgctgcagcacaccctggaccaaggctacgacctgatc
ctggaaatcgactggcaaggtgcccagcaggtgcgcaagctgatgccagaggcgctgtcg
gtgttcatcctgcctccaagtcaggaggcgcttcgccaccgcctggacggacgcgggcag
gacagcgaagagatcattgccgggcgcatgaaggaagcggtcagcgagatggtgcactac
gacgagtatgactacgtgatcatcaatgatgatttcgacgcggcgctggcagacttgaaa
gcggtgttccgctcgaatcggctgctgttgaagaagcagcagcagcgtcatgcggcgctg
ctgaagcaaatgatcggctaa

DBGET integrated database retrieval system