KEGG   Pseudomonas putida ND6: YSA_04831Help
Entry
YSA_04831         CDS       T02170                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00230  Purine metabolism
ppi01100  Metabolic pathways
Module
ppi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YSA_04831
Enzymes [BR:ppi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     YSA_04831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 Zeta_toxin RsgA_GTPase AAA_22 ABC_tran cobW MMR_HSR1 AAA_18
Motif
Other DBs
NCBI-ProteinID: AFK69383
UniProt: I3UV62
Position
2614731..2615351
Genome map
AA seq 206 aa AA seqDB search
MNHSSGTLYIVSAPSGAGKTSLVTALTKDDQQIRVSVSHTTRAMRPGEQHGVNYHFVVHE
EFKTLIAQGDFLEHAEVFGNFYGTSRSALQHTLDQGYDLILEIDWQGAQQVRKLMPEALS
VFILPPSQEALRHRLDGRGQDSEEIIAGRMKEAVSEMVHYDEYDYVIINDDFDAALADLK
AVFRSNRLLLKKQQQRHAALLKQMIG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacagcagcggcaccctctacatcgtttcggccccctcgggtgccggcaagacc
agcctggtcaccgccctgaccaaagacgaccagcagattcgcgtctcggtctcgcacact
acccgcgccatgcgcccgggcgagcagcacggggtgaactatcacttcgtcgtccacgag
gagttcaagacgctgatcgcgcaaggagactttctggagcatgccgaagtgttcggcaac
ttctacggtacttcgcgcagcgcgctgcagcacaccctggaccaaggctacgacctgatc
ctggaaatcgactggcaaggtgcccagcaggtgcgcaagctgatgccagaggcgctgtcg
gtgttcatcctgcctccaagtcaggaggcgcttcgccaccgcctggacggacgcgggcag
gacagcgaagagatcattgccgggcgcatgaaggaagcggtcagcgagatggtgcactac
gacgagtatgactacgtgatcatcaatgatgatttcgacgcggcgctggcagacttgaaa
gcggtgttccgctcgaatcggctgctgttgaagaagcagcagcagcgtcatgcggcgctg
ctgaagcaaatgatcggctaa

DBGET integrated database retrieval system