KEGG   Pseudomonas putida ND6: YSA_05126Help
Entry
YSA_05126         CDS       T02170                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00260  Glycine, serine and threonine metabolism
ppi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01130  Biosynthesis of antibiotics
ppi01230  Biosynthesis of amino acids
Module
ppi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YSA_05126
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YSA_05126
Enzymes [BR:ppi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YSA_05126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PEP_mutase ThiG KDGP_aldolase PA BtpA
Motif
Other DBs
NCBI-ProteinID: AFK69542
UniProt: I3UVM1
Position
complement(2768016..2768825)
Genome map
AA seq 269 aa AA seqDB search
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVDTFVAEAKA
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAANIARLADGVVVGSALVDKI
AQAKSADQAVTDVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaacaacgcttcgccgagctgaaggccgaaggccgctcggcactggtc
accttcgtcacagctggcgacccgggctacgacgcctcgctgcagatcctcaagggcctg
ccggctgctggcgccgacgtgatcgagctgggcatgccgttcaccgacccgatggccgat
ggcgtggccattcagttggccaccctgcgcgcccttgaagctggccagaccttggccaag
accctgcagatggttcgcgaattccgtgtggataaccagaccacgccgatcgtgctgatg
ggctactacaaccctatccaccgctttggcgtggacacgttcgtggctgaagccaaggca
gcgggcgtcgatggcctgatcatcgtcgaccttccgccagagcacgacgccgaactggct
accccggcccaggctgcaggcatcgacttcatccgcctgaccactccgaccaccgacgac
gcgcgcctgccgcgcgtgctggagcgcagctccgggttcgtctactacgtgtcggtggct
ggtgtaaccggtgcaggttcggcgaccaccgagcatgtgaccgaagccattgcccgcctg
cgccggcataccgatctgccgatcagcgttggcttcggcattcgcacgccggaacaggct
gcgaacattgcccgcttggcggatggtgtggtggtgggctcggcactggtcgacaagatc
gcccaggccaaaagcgccgatcaggcggtgaccgatgtattgagcctgtgctcggcactg
gctgaaggggtgcgtggcgcacgccgctaa

DBGET integrated database retrieval system