KEGG   Pseudomonas putida ND6: YSA_05218Help
Entry
YSA_05218         CDS       T02170                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ppi  Pseudomonas putida ND6
Brite
Enzymes [BR:ppi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     YSA_05218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2812722..2814659
Genome map
AA seq 645 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALVGQLQGLPLPSDISRPL
KKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKPGEETRPGFLQRLFGSREEDAQA
GAELEPVALPAAEVVPQAAGSAEPSRPDDVDALQPLPAPAAPTAEVAEAPELELEAFGPA
LIETAEMAPAPLPRDKAPLPEAAVSVSEPLAEAEPLQALEETFGEDGPYALPYAVEPPYS
QVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAITDS
GQHEFETYLQQLNERLEGFQSHLHEASAGHADNSTAARELDSQLREHVDGLQSSVQGAAD
VDSLKHILENRLEGLLLTMDEHKHERDRREQELAGRLQGLSERVASMEHEALGYREHLEE
QRQKALLDPLTGLPNRAAWSEQVEREMLDWQENGGHLAMAILDLDHFKRINDNYGHLAGD
KVLKIVADQLRKRLRGRDFIARFGGEEFVLLLPQTTPAVAAQMAEVLRATVEACPFHFKG
ERVVITTSIGLGAFRSGERSDQVLKRADAALYRAKEQGRNRVEQG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaataccttaaaagcatcgagcagcaagaa
aagctcgaacgccgttgggatgcccgtcttgacctgctgcgtcgaggcctggtgcgcagc
accctggctgctgaaggcagtgacaaggtggtagacgagtgcatgaaggaaatgcgcgat
gtcattcgcagcgacaacatggacgccggcctcgccggcttgattccgcgccttgagaaa
gcggtactggattccgaacagcgtcgcgaaacccgcatgaaccaagtcagcgatgcgctg
accgcactggttggccaactgcaaggcctgcccctgcccagtgatatctcgcggccattg
aaaaaactggcgaagaagctcgacggcggggttgcccagtcacgcgagctgccgccgctg
ttgggcgagttgagcggcttgcaggggcgcgcgctgtcggcccttggcaagccgggtgaa
gaaacccgacccgggtttctgcagcggttgttcggaagccgcgaggaagatgcacaggca
ggagcagagcttgagccggtggcgttgcctgctgccgaggttgtgccccaggcagccggc
agtgccgagccctcgcggcccgatgacgtcgatgcgctacaaccgttgccggcccctgct
gctccgactgccgaggtggccgaagcgcccgagcttgagctggaggcatttggcccggcg
ctgatcgaaacggccgaaatggcgccagccccgttgccaagggacaaggcgccattgccg
gaagctgcagtttccgtcagcgagccgttggctgaggcagaacccttacaagcccttgaa
gaaacctttggtgaagacggcccctatgctctgccctacgcagtggagccgccttacagc
caggttgccgcgcacatcgagcagaccctgatcggtctgctcgatgaccttagcctgccc
gagcgccacaaggctcaggcgttggaaatgcgcgagcgggttgcgcgcggcttgaactgg
tatgagctgatcccggtgctggatgacttggcagtcctcatgctggcgatcaccgacagc
ggccagcacgaattcgaaacctacctgcagcagctcaatgaacgcctggaaggtttccaa
agccacctgcacgaggccagcgccggtcacgcggacaacagcaccgctgcccgcgagctg
gatagccaactgcgtgagcacgtcgacggcctgcagagcagcgtgcaaggtgccgccgat
gtagacagcctcaagcacattctggaaaaccgcctggaaggcttgctgctgaccatggac
gagcacaagcacgagcgtgatcgccgcgagcaggaactggccggtcgcctgcaaggcttg
tcggagcgggtggcgagcatggagcatgaggcgcttggctatcgcgagcacctggaagaa
cagcgccagaaagcgctgctggacccgctcaccggcctgcccaaccgtgcggcctggagc
gagcaagtcgaacgcgaaatgcttgactggcaggaaaacggcggtcatctggcgatggcg
attcttgacctggaccatttcaaacgcatcaacgacaactatggtcatctggctggggac
aaggtcctcaagatcgtggccgaccagttgcgcaagcgtctgcggggccgggatttcatc
gcccgttttggcggcgaggaattcgtcttgctgttgccgcagactacgcccgcagtcgct
gcgcagatggccgaggtgttgcgcgccacagtcgaagcctgcccattccacttcaagggt
gagcgggtagtgatcaccacctccatcggcctgggtgcattccgttctggcgaacgcagc
gatcaggtgctcaaacgagccgatgcagcgctgtaccgggcaaaggagcaggggcgtaat
cgcgtcgagcaaggctag

DBGET integrated database retrieval system