KEGG   Pseudomonas putida ND6: YSA_05692Help
Entry
YSA_05692         CDS       T02170                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00010  Glycolysis / Gluconeogenesis
ppi00020  Citrate cycle (TCA cycle)
ppi00620  Pyruvate metabolism
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01200  Carbon metabolism
Module
ppi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YSA_05692
   00020 Citrate cycle (TCA cycle)
    YSA_05692
   00620 Pyruvate metabolism
    YSA_05692
Enzymes [BR:ppi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YSA_05692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 PYNP_C RnfC_N HlyD_3 NQRA DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AFK69852
UniProt: I3UWI1
Position
complement(3074948..3076582)
Genome map
AA seq 544 aa AA seqDB search
MSELIRVPDIGSGEGEIIELFVKVGDRIEADQSLLTLESDKASMEIPAPKAGVIKELKVK
LGDRLKEGDELLVLEAEGAAAAAPEAPAAAPAAAPAPAAEAAPAAPAAAPAAASVQDIHV
PDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVEEVLCKLEDEVG
TGDLIFKLKVAGAAPAAAPAPAAAPAPAKAEAAPAAAPAAAAPAAAPAPAATAPAAGSNA
KVHAGPAVRQLAREFGVELGAVAATGPHGRILKEDVQVYVKAMMQKAKEAPAAAGATGGA
GIPPIPAVDFSKFGEVEEVALTRLMQVGAANLHRSWLNVPHVTQFDSADITELEAFRVAQ
KAVAEKAGVKLTVLPLLLKACAFLLKELPDFNSSLAPSGKAIIRKKYVHIGFAVDTPDGL
LVPVIKNVDQKSLLQLAAEAAALAEKARTKKLSADEMQGACFTISSLGHIGGTGFTPIVN
APEVAILGVSKATMQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTKRLGDVLGDIR
TMLL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacctgacatcggcagcggtgaaggtgaaatcatcgagctg
ttcgtcaaggtcggtgatcgtatcgaggctgaccagagcctgctgaccctggagtccgac
aaggcctccatggaaattccggcgcccaaggccggcgtcatcaaggaactgaaggtcaag
ctgggcgaccgcctgaaagaaggcgacgagctgctggtcctggaagccgagggcgccgct
gctgcggcccctgaggctccggccgctgctccggctgcggcgccagcgccagccgctgaa
gccgctccggctgctccggccgcagccccggctgctgccagcgtgcaggacatccacgtg
ccggacatcggttcgtcgggcaaggccaagatcatcgaagtgctggtcaaggtcggcgac
accgtcgaagccgaccagtcgctgattaccctggagtccgacaaggcttccatggaaatc
ccgtcgccggccgccggcgtggtcgaagaagtgctgtgcaagctggaagacgaagtcggc
actggcgacctgatcttcaagctgaaagtggcgggtgccgccccggctgccgcgccggca
ccggctgctgctcctgcaccagccaaggctgaggctgctccggctgccgcacctgccgct
gcagccccggctgctgcccctgcaccggctgcgaccgcaccggccgctggcagcaatgcc
aaggttcacgcaggccccgctgttcgtcagctggcccgtgaattcggtgtagagctgggt
gcagttgctgccaccggcccgcacggtcgcatcctgaaagaagacgtgcaggtctacgtc
aaggccatgatgcagaaggccaaggaagcgccggcagccgccggtgcgaccggtggtgct
ggcatcccgccaatccctgccgtggacttcagcaagttcggtgaagtggaagaagtggcc
ctgacccgcctgatgcaggtcggtgctgccaacctgcaccgcagctggctcaacgtgccg
cacgtgacccagttcgactctgccgacatcaccgagctggaagccttccgcgttgcgcag
aaggccgtggccgagaaagctggcgtgaagctgaccgtgctgcctctgctgctcaaggcc
tgcgccttcctgctcaaggaactgccggacttcaacagctcgctggcgccaagcggcaag
gccatcatccgcaagaagtacgtgcacatcggcttcgccgtggacaccccggacggcctg
ctggtccctgtgatcaagaacgtcgaccagaagagcctgctgcaactggctgccgaagcc
gctgcactggccgagaaggcgcgcaccaagaagctgtcggccgacgagatgcaaggcgct
tgcttcaccatctccagcctcggccacattggcggcaccggcttcacgccgatcgtcaac
gcgccggaagtggctatcctgggcgtctccaaggcgaccatgcagccagtctgggatggc
aaggccttccagccaaagctgatgctgccgctgtcgctgtcctacgatcaccgtgtgatc
aacggcgctgccgccgcgcgcttcaccaagcgcctgggcgacgtgctgggcgatatccgc
accatgctgctgtaa

DBGET integrated database retrieval system